Class b: All beta proteins [48724] (174 folds) |
Fold b.43: Reductase/isomerase/elongation factor common domain [50412] (4 superfamilies) barrel, closed; n=6, S=10; greek-key |
Superfamily b.43.3: Translation proteins [50447] (6 families) |
Family b.43.3.1: Elongation factors [50448] (10 proteins) |
Protein Elongation factor 2 (eEF-2), domain II [82118] (1 species) |
Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [82119] (13 PDB entries) Uniprot P32324 |
Domain d2e1ra1: 2e1r A:344-481 [131966] Other proteins in same PDB: d2e1ra2, d2e1ra3, d2e1ra4, d2e1ra5 automatically matched to d1n0ua1 complexed with gdp, sod |
PDB Entry: 2e1r (more details), 3.15 Å
SCOP Domain Sequences for d2e1ra1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2e1ra1 b.43.3.1 (A:344-481) Elongation factor 2 (eEF-2), domain II {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} spvtaqayraeqlyegpaddanciaikncdpkadlmlyvskmvptsdkgrfyafgrvfag tvksgqkvriqgpnyvpgkkddlfikaiqrvvlmmgrfvepiddcpagniiglvgidqfl lktgtlttsetahnmkvm
Timeline for d2e1ra1:
View in 3D Domains from same chain: (mouse over for more information) d2e1ra2, d2e1ra3, d2e1ra4, d2e1ra5 |