Lineage for d2e1ra1 (2e1r A:344-481)

  1. Root: SCOP 1.75
  2. 781541Class b: All beta proteins [48724] (174 folds)
  3. 801216Fold b.43: Reductase/isomerase/elongation factor common domain [50412] (4 superfamilies)
    barrel, closed; n=6, S=10; greek-key
  4. 801236Superfamily b.43.3: Translation proteins [50447] (6 families) (S)
  5. 801237Family b.43.3.1: Elongation factors [50448] (10 proteins)
  6. 801238Protein Elongation factor 2 (eEF-2), domain II [82118] (1 species)
  7. 801239Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [82119] (13 PDB entries)
    Uniprot P32324
  8. 801258Domain d2e1ra1: 2e1r A:344-481 [131966]
    Other proteins in same PDB: d2e1ra2, d2e1ra3, d2e1ra4, d2e1ra5
    automatically matched to d1n0ua1
    complexed with gdp, sod

Details for d2e1ra1

PDB Entry: 2e1r (more details), 3.15 Å

PDB Description: structure of eef2 in complex with a sordarin derivative
PDB Compounds: (A:) Elongation factor 2

SCOP Domain Sequences for d2e1ra1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2e1ra1 b.43.3.1 (A:344-481) Elongation factor 2 (eEF-2), domain II {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
spvtaqayraeqlyegpaddanciaikncdpkadlmlyvskmvptsdkgrfyafgrvfag
tvksgqkvriqgpnyvpgkkddlfikaiqrvvlmmgrfvepiddcpagniiglvgidqfl
lktgtlttsetahnmkvm

SCOP Domain Coordinates for d2e1ra1:

Click to download the PDB-style file with coordinates for d2e1ra1.
(The format of our PDB-style files is described here.)

Timeline for d2e1ra1: