SCOPe 2.08: Domain d2dysx_: 2dys X:

Lineage for d2dysx_ (2dys X:)

1. Root: SCOPe 2.08

2. Class f: Membrane and cell surface proteins and peptides [56835] (69 folds)

3. Fold f.23: Single transmembrane helix [81407] (42 superfamilies)
   not a true fold
   annotated by the SCOP(e) curators as 'not a true fold'

4. Superfamily f.23.5: Mitochondrial cytochrome c oxidase subunit VIIb [81423] (1 family)
   automatically mapped to Pfam PF05392

5. Family f.23.5.1: Mitochondrial cytochrome c oxidase subunit VIIb [81422] (2 proteins)

6. Protein automated matches [190272] (1 species)
   not a true protein

7. Species Cow (Bos taurus) [TaxId:9913] [187064] (26 PDB entries)

8. Domain d2dysx_: 2dys X: [131952]
   Other proteins in same PDB: d2dysa_, d2dysb1, d2dysb2, d2dysc_, d2dysd_, d2dyse_, d2dysf_, d2dysg_, d2dysh_, d2dysi_, d2dysj_, d2dysl_, d2dysm_, d2dysn_, d2dyso1, d2dyso2, d2dysp_, d2dysq_, d2dysr_, d2dyss_, d2dyst_, d2dysu_, d2dysv_, d2dysw_, d2dysy_, d2dysz_
   automated match to d1occk_
   complexed with cdl, chd, cu, cua, dcw, dmu, hea, mg, na, pek, pgv, psc, tgl, unx, zn

Details for d2dysx_

PDB Entry: 2dys, 2.2 Å

PDB Description: Bovine heart cytochrome C oxidase modified by DCCD

PDB Compounds: (X:) Cytochrome c oxidase polypeptide VIIb

SCOPe Domain Sequences for d2dysx_:

Sequence; same for both SEQRES and ATOM records:

>d2dysx_ f.23.5.1 (X:) automated matches {Cow (Bos taurus) [TaxId: 9913]}
apdfhdkygnavlasgatfcvavwvymatqigiewnpspvgrvtpkewr

Timeline for d2dysx_:

• d2dysx_ first appeared in SCOP 1.73, called d2dysx1
  
• d2dysx_ appears in SCOPe 2.07