Lineage for d2dysv1 (2dys V:1-73)

  1. Root: SCOP 1.75
  2. 886031Class f: Membrane and cell surface proteins and peptides [56835] (58 folds)
  3. 887128Fold f.23: Single transmembrane helix [81407] (38 superfamilies)
    not a true fold
  4. 887193Superfamily f.23.3: Mitochondrial cytochrome c oxidase subunit VIc [81415] (1 family) (S)
  5. 887194Family f.23.3.1: Mitochondrial cytochrome c oxidase subunit VIc [81414] (1 protein)
  6. 887195Protein Mitochondrial cytochrome c oxidase subunit VIc [81413] (1 species)
    function unknown, probably acts as a regulator or is required for the assembly
  7. 887196Species Cow (Bos taurus) [TaxId:9913] [81412] (14 PDB entries)
  8. 887210Domain d2dysv1: 2dys V:1-73 [131950]
    Other proteins in same PDB: d2dysa1, d2dysb1, d2dysb2, d2dysc1, d2dysd1, d2dyse1, d2dysf1, d2dysg1, d2dysh1, d2dysj1, d2dysk1, d2dysl1, d2dysm1, d2dysn1, d2dyso1, d2dyso2, d2dysp1, d2dysq1, d2dysr1, d2dyss1, d2dyst1, d2dysu1, d2dysw1, d2dysx1, d2dysy1, d2dysz1
    automatically matched to d1occi_
    complexed with cdl, chd, cu, cua, dmu, glh, hea, mg, na, pek, pgv, psc, tgl, unx, zn

Details for d2dysv1

PDB Entry: 2dys (more details), 2.2 Å

PDB Description: Bovine heart cytochrome C oxidase modified by DCCD
PDB Compounds: (V:) Cytochrome c oxidase polypeptide VIc

SCOP Domain Sequences for d2dysv1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2dysv1 f.23.3.1 (V:1-73) Mitochondrial cytochrome c oxidase subunit VIc {Cow (Bos taurus) [TaxId: 9913]}
stalakpqmrgllarrlrfhivgafmvslgfatfykfavaekrkkayadfyrnydsmkdf
eemrkagifqsak

SCOP Domain Coordinates for d2dysv1:

Click to download the PDB-style file with coordinates for d2dysv1.
(The format of our PDB-style files is described here.)

Timeline for d2dysv1: