Lineage for d2dysu1 (2dys U:7-85)

  1. Root: SCOP 1.73
  2. 631650Class a: All alpha proteins [46456] (258 folds)
  3. 642471Fold a.51: Cytochrome c oxidase subunit h [47693] (1 superfamily)
    4 helices; irregular array, disulfide-linked
  4. 642472Superfamily a.51.1: Cytochrome c oxidase subunit h [47694] (1 family) (S)
  5. 642473Family a.51.1.1: Cytochrome c oxidase subunit h [47695] (1 protein)
  6. 642474Protein Cytochrome c oxidase subunit h [47696] (1 species)
  7. 642475Species Cow (Bos taurus) [TaxId:9913] [47697] (14 PDB entries)
  8. 642489Domain d2dysu1: 2dys U:7-85 [131949]
    Other proteins in same PDB: d2dysa1, d2dysb1, d2dysb2, d2dysc1, d2dysd1, d2dyse1, d2dysf1, d2dysg1, d2dysi1, d2dysj1, d2dysk1, d2dysl1, d2dysm1, d2dysn1, d2dyso1, d2dyso2, d2dysp1, d2dysq1, d2dysr1, d2dyss1, d2dyst1, d2dysv1, d2dysw1, d2dysx1, d2dysy1, d2dysz1
    automatically matched to d1ocrh_
    complexed with cdl, chd, cu, cua, dmu, glh, hea, mg, na, pek, pgv, psc, tgl, unx, zn

Details for d2dysu1

PDB Entry: 2dys (more details), 2.2 Å

PDB Description: Bovine heart cytochrome C oxidase modified by DCCD
PDB Compounds: (U:) Cytochrome c oxidase subunit VIb isoform 1

SCOP Domain Sequences for d2dysu1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2dysu1 a.51.1.1 (U:7-85) Cytochrome c oxidase subunit h {Cow (Bos taurus) [TaxId: 9913]}
kiknyqtapfdsrfpnqnqtrncwqnyldfhrcekamtakggdvsvcewyrrvykslcpi
swvstwddrraegtfpgki

SCOP Domain Coordinates for d2dysu1:

Click to download the PDB-style file with coordinates for d2dysu1.
(The format of our PDB-style files is described here.)

Timeline for d2dysu1: