SCOP 1.73: Domain d2dyst1: 2dys T:1-84

Lineage for d2dyst1 (2dys T:1-84)

1. Root: SCOP 1.73

2. Class f: Membrane and cell surface proteins and peptides [56835] (50 folds)

3. Fold f.23: Single transmembrane helix [81407] (30 superfamilies)
   not a true fold

4. Superfamily f.23.2: Mitochondrial cytochrome c oxidase subunit VIa [81411] (1 family)

5. Family f.23.2.1: Mitochondrial cytochrome c oxidase subunit VIa [81410] (1 protein)

6. Protein Mitochondrial cytochrome c oxidase subunit VIa [81409] (1 species)
   probably responsible for the dimerization of the mitochondrial cytochrome c oxidase

7. Species Cow (Bos taurus) [TaxId:9913] [81408] (14 PDB entries)

8. Domain d2dyst1: 2dys T:1-84 [131948]
   Other proteins in same PDB: d2dysa1, d2dysb1, d2dysb2, d2dysc1, d2dysd1, d2dyse1, d2dysf1, d2dysh1, d2dysi1, d2dysj1, d2dysk1, d2dysl1, d2dysm1, d2dysn1, d2dyso1, d2dyso2, d2dysp1, d2dysq1, d2dysr1, d2dyss1, d2dysu1, d2dysv1, d2dysw1, d2dysx1, d2dysy1, d2dysz1
   automatically matched to d1occg_
   complexed with cdl, chd, cu, cua, dmu, glh, hea, mg, na, pek, pgv, psc, tgl, unx, zn

Details for d2dyst1

PDB Entry: 2dys, 2.2 Å

PDB Description: Bovine heart cytochrome C oxidase modified by DCCD

PDB Compounds: (T:) Cytochrome c oxidase polypeptide VIa-heart

SCOP Domain Sequences for d2dyst1:

Sequence; same for both SEQRES and ATOM records:

>d2dyst1 f.23.2.1 (T:1-84) Mitochondrial cytochrome c oxidase subunit VIa {Cow (Bos taurus) [TaxId: 9913]}
asaakgdhggtgartwrfltfglalpsvalctlnswlhsghrerpafipyhhlrirtkpf
swgdgnhtffhnprvnplptgyek

Timeline for d2dyst1:

• d2dyst1 is new in SCOP 1.73
  
• d2dyst1 appears in SCOP 1.75
  
• d2dyst1 appears in the current release, SCOPe 2.08, called d2dyst_