Lineage for d2dysq1 (2dys Q:4-147)

  1. Root: SCOP 1.75
  2. 886031Class f: Membrane and cell surface proteins and peptides [56835] (58 folds)
  3. 887128Fold f.23: Single transmembrane helix [81407] (38 superfamilies)
    not a true fold
  4. 887129Superfamily f.23.1: Mitochondrial cytochrome c oxidase subunit IV [81406] (1 family) (S)
  5. 887130Family f.23.1.1: Mitochondrial cytochrome c oxidase subunit IV [81405] (1 protein)
  6. 887131Protein Mitochondrial cytochrome c oxidase subunit IV [81404] (1 species)
    function unknown, probably acts as a regulator or is required for the assembly
  7. 887132Species Cow (Bos taurus) [TaxId:9913] [81403] (14 PDB entries)
  8. 887146Domain d2dysq1: 2dys Q:4-147 [131945]
    Other proteins in same PDB: d2dysa1, d2dysb1, d2dysb2, d2dysc1, d2dyse1, d2dysf1, d2dysg1, d2dysh1, d2dysi1, d2dysj1, d2dysk1, d2dysl1, d2dysm1, d2dysn1, d2dyso1, d2dyso2, d2dysp1, d2dysr1, d2dyss1, d2dyst1, d2dysu1, d2dysv1, d2dysw1, d2dysx1, d2dysy1, d2dysz1
    automatically matched to d1occd_
    complexed with cdl, chd, cu, cua, dmu, glh, hea, mg, na, pek, pgv, psc, tgl, unx, zn

Details for d2dysq1

PDB Entry: 2dys (more details), 2.2 Å

PDB Description: Bovine heart cytochrome C oxidase modified by DCCD
PDB Compounds: (Q:) Cytochrome c oxidase subunit 4 isoform 1

SCOP Domain Sequences for d2dysq1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2dysq1 f.23.1.1 (Q:4-147) Mitochondrial cytochrome c oxidase subunit IV {Cow (Bos taurus) [TaxId: 9913]}
svvksedyalpsyvdrrdyplpdvahvknlsasqkalkekekaswsslsidekvelyrlk
fkesfaemnrstnewktvvgaamffigftallliwekhyvygpiphtfeeewvakqtkrm
ldmkvapiqgfsakwdydknewkk

SCOP Domain Coordinates for d2dysq1:

Click to download the PDB-style file with coordinates for d2dysq1.
(The format of our PDB-style files is described here.)

Timeline for d2dysq1: