Lineage for d2dysk_ (2dys K:)

  1. Root: SCOPe 2.03
  2. 1454900Class f: Membrane and cell surface proteins and peptides [56835] (57 folds)
  3. 1456646Fold f.23: Single transmembrane helix [81407] (38 superfamilies)
    not a true fold
  4. 1456857Superfamily f.23.5: Mitochondrial cytochrome c oxidase subunit VIIb [81423] (1 family) (S)
    automatically mapped to Pfam PF05392
  5. 1456858Family f.23.5.1: Mitochondrial cytochrome c oxidase subunit VIIb [81422] (2 proteins)
  6. 1456876Protein automated matches [190272] (1 species)
    not a true protein
  7. 1456877Species Cow (Bos taurus) [TaxId:9913] [187064] (16 PDB entries)
  8. 1456901Domain d2dysk_: 2dys K: [131938]
    Other proteins in same PDB: d2dysa_, d2dysb1, d2dysb2, d2dysc_, d2dysd_, d2dyse_, d2dysf_, d2dysg_, d2dysh_, d2dysi_, d2dysj_, d2dysl_, d2dysm_, d2dysn_, d2dyso1, d2dyso2, d2dysp_, d2dysq_, d2dysr_, d2dyss_, d2dyst_, d2dysu_, d2dysv_, d2dysw_, d2dysy_, d2dysz_
    automated match to d1occk_
    complexed with cdl, chd, cu, cua, dcw, dmu, hea, mg, na, pek, pgv, psc, tgl, unx, zn

Details for d2dysk_

PDB Entry: 2dys (more details), 2.2 Å

PDB Description: Bovine heart cytochrome C oxidase modified by DCCD
PDB Compounds: (K:) Cytochrome c oxidase polypeptide VIIb

SCOPe Domain Sequences for d2dysk_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2dysk_ f.23.5.1 (K:) automated matches {Cow (Bos taurus) [TaxId: 9913]}
apdfhdkygnavlasgatfcvavwvymatqigiewnpspvgrvtpkewr

SCOPe Domain Coordinates for d2dysk_:

Click to download the PDB-style file with coordinates for d2dysk_.
(The format of our PDB-style files is described here.)

Timeline for d2dysk_: