Lineage for d2dysk1 (2dys K:6-54)

  1. Root: SCOP 1.73
  2. 744527Class f: Membrane and cell surface proteins and peptides [56835] (50 folds)
  3. 745533Fold f.23: Single transmembrane helix [81407] (30 superfamilies)
    not a true fold
  4. 745662Superfamily f.23.5: Mitochondrial cytochrome c oxidase subunit VIIb [81423] (1 family) (S)
  5. 745663Family f.23.5.1: Mitochondrial cytochrome c oxidase subunit VIIb [81422] (1 protein)
  6. 745664Protein Mitochondrial cytochrome c oxidase subunit VIIb [81421] (1 species)
    function unknown, probably acts as a regulator or is required for the assembly
  7. 745665Species Cow (Bos taurus) [TaxId:9913] [81420] (14 PDB entries)
  8. 745678Domain d2dysk1: 2dys K:6-54 [131938]
    Other proteins in same PDB: d2dysa1, d2dysb1, d2dysb2, d2dysc1, d2dysd1, d2dyse1, d2dysf1, d2dysg1, d2dysh1, d2dysi1, d2dysj1, d2dysl1, d2dysm1, d2dysn1, d2dyso1, d2dyso2, d2dysp1, d2dysq1, d2dysr1, d2dyss1, d2dyst1, d2dysu1, d2dysv1, d2dysw1, d2dysy1, d2dysz1
    automatically matched to d1occk_
    complexed with cdl, chd, cu, cua, dmu, glh, hea, mg, na, pek, pgv, psc, tgl, unx, zn

Details for d2dysk1

PDB Entry: 2dys (more details), 2.2 Å

PDB Description: Bovine heart cytochrome C oxidase modified by DCCD
PDB Compounds: (K:) Cytochrome c oxidase polypeptide VIIb

SCOP Domain Sequences for d2dysk1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2dysk1 f.23.5.1 (K:6-54) Mitochondrial cytochrome c oxidase subunit VIIb {Cow (Bos taurus) [TaxId: 9913]}
apdfhdkygnavlasgatfcvavwvymatqigiewnpspvgrvtpkewr

SCOP Domain Coordinates for d2dysk1:

Click to download the PDB-style file with coordinates for d2dysk1.
(The format of our PDB-style files is described here.)

Timeline for d2dysk1: