SCOP 1.75: Domain d2dysc1: 2dys C:3-261

Lineage for d2dysc1 (2dys C:3-261)

1. Root: SCOP 1.75

2. Class f: Membrane and cell surface proteins and peptides [56835] (58 folds)

3. Fold f.25: Cytochrome c oxidase subunit III-like [81453] (1 superfamily)
   core: 7 transmembrane helices organized into two bundles, one formed by the first two helices and the other by the rest

4. Superfamily f.25.1: Cytochrome c oxidase subunit III-like [81452] (1 family)

5. Family f.25.1.1: Cytochrome c oxidase subunit III-like [81451] (3 proteins)
   function unknown, possibly involved in the assembly or form the entrance to "oxygen" channel

6. Protein Mitochondrial cytochrome c oxidase, subunit III [81445] (1 species)

7. Species Cow (Bos taurus) [TaxId:9913] [81444] (14 PDB entries)

8. Domain d2dysc1: 2dys C:3-261 [131930]
   Other proteins in same PDB: d2dysa1, d2dysb1, d2dysb2, d2dysd1, d2dyse1, d2dysf1, d2dysg1, d2dysh1, d2dysi1, d2dysj1, d2dysk1, d2dysl1, d2dysm1, d2dysn1, d2dyso1, d2dyso2, d2dysq1, d2dysr1, d2dyss1, d2dyst1, d2dysu1, d2dysv1, d2dysw1, d2dysx1, d2dysy1, d2dysz1
   automatically matched to d1v54c_
   complexed with cdl, chd, cu, cua, dmu, glh, hea, mg, na, pek, pgv, psc, tgl, unx, zn

Details for d2dysc1

PDB Entry: 2dys, 2.2 Å

PDB Description: Bovine heart cytochrome C oxidase modified by DCCD

PDB Compounds: (C:) Cytochrome c oxidase subunit 3

SCOP Domain Sequences for d2dysc1:

Sequence; same for both SEQRES and ATOM records:

>d2dysc1 f.25.1.1 (C:3-261) Mitochondrial cytochrome c oxidase, subunit III {Cow (Bos taurus) [TaxId: 9913]}
hqthayhmvnpspwpltgalsallmtsgltmwfhfnsmtllmiglttnmltmyqwwrdvi
restfqghhtpavqkglrygmilfiisqvlfftgffwafyhsslaptpelggcwpptgih
plnplevpllntsvllasgvsitwahhslmegdrkhmlqalfititlgvyftllqaseyy
eapftisdgvygstffvatgfhglhviigstflivcffrqlkfhftsnhhfgfeaaawyw
hfvdvvwlflyvsiywwgs

Timeline for d2dysc1:

• d2dysc1 first appeared in SCOP 1.73
  
• d2dysc1 is called d2dysc_ in SCOPe 2.01
  
• d2dysc1 appears in the current release, SCOPe 2.08, called d2dysc_