Lineage for d2dyrz1 (2dyr Z:1-43)

  1. Root: SCOP 1.75
  2. 886031Class f: Membrane and cell surface proteins and peptides [56835] (58 folds)
  3. 887128Fold f.23: Single transmembrane helix [81407] (38 superfamilies)
    not a true fold
  4. 887321Superfamily f.23.7: Mitochondrial cytochrome c oxidase subunit VIIIb (aka IX) [81431] (1 family) (S)
  5. 887322Family f.23.7.1: Mitochondrial cytochrome c oxidase subunit VIIIb (aka IX) [81430] (1 protein)
  6. 887323Protein Mitochondrial cytochrome c oxidase subunit VIIIb (aka IX) [81429] (1 species)
    function unknown, probably acts as a regulator or is required for the assembly
  7. 887324Species Cow (Bos taurus) [TaxId:9913] [81428] (14 PDB entries)
  8. 887328Domain d2dyrz1: 2dyr Z:1-43 [131926]
    Other proteins in same PDB: d2dyra1, d2dyrb1, d2dyrb2, d2dyrc1, d2dyrd1, d2dyre1, d2dyrf1, d2dyrg1, d2dyrh1, d2dyri1, d2dyrj1, d2dyrk1, d2dyrl1, d2dyrn1, d2dyro1, d2dyro2, d2dyrp1, d2dyrq1, d2dyrr1, d2dyrs1, d2dyrt1, d2dyru1, d2dyrv1, d2dyrw1, d2dyrx1, d2dyry1
    automatically matched to d1occm_
    complexed with cdl, chd, cu, cua, dmu, hea, mg, na, pek, pgv, psc, tgl, unx, zn

Details for d2dyrz1

PDB Entry: 2dyr (more details), 1.8 Å

PDB Description: Bovine heart cytochrome C oxidase at the fully oxidized state
PDB Compounds: (Z:) Cytochrome c oxidase polypeptide VIII-heart

SCOP Domain Sequences for d2dyrz1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2dyrz1 f.23.7.1 (Z:1-43) Mitochondrial cytochrome c oxidase subunit VIIIb (aka IX) {Cow (Bos taurus) [TaxId: 9913]}
itakpaktptspkeqaiglsvtflsfllpagwvlyhldnykks

SCOP Domain Coordinates for d2dyrz1:

Click to download the PDB-style file with coordinates for d2dyrz1.
(The format of our PDB-style files is described here.)

Timeline for d2dyrz1: