Lineage for d2dyry_ (2dyr Y:)

  1. Root: SCOPe 2.07
  2. 2626587Class f: Membrane and cell surface proteins and peptides [56835] (60 folds)
  3. 2630215Fold f.23: Single transmembrane helix [81407] (42 superfamilies)
    not a true fold
  4. 2630744Superfamily f.23.6: Mitochondrial cytochrome c oxidase subunit VIIc (aka VIIIa) [81427] (1 family) (S)
    automatically mapped to Pfam PF02935
  5. 2630745Family f.23.6.1: Mitochondrial cytochrome c oxidase subunit VIIc (aka VIIIa) [81426] (2 proteins)
  6. 2630746Protein Mitochondrial cytochrome c oxidase subunit VIIc (aka VIIIa) [81425] (1 species)
    function unknown, probably acts as a regulator or is required for the assembly
  7. 2630747Species Cow (Bos taurus) [TaxId:9913] [81424] (49 PDB entries)
  8. 2630753Domain d2dyry_: 2dyr Y: [131925]
    Other proteins in same PDB: d2dyra_, d2dyrb1, d2dyrb2, d2dyrc_, d2dyrd_, d2dyre_, d2dyrf_, d2dyrg_, d2dyrh_, d2dyri_, d2dyrj_, d2dyrk_, d2dyrm_, d2dyrn_, d2dyro1, d2dyro2, d2dyrp_, d2dyrq_, d2dyrr_, d2dyrs_, d2dyrt_, d2dyru_, d2dyrv_, d2dyrw_, d2dyrx_, d2dyrz_
    automated match to d1occl_
    complexed with cdl, chd, cu, cua, dmu, hea, mg, na, pek, pgv, psc, tgl, unx, zn

Details for d2dyry_

PDB Entry: 2dyr (more details), 1.8 Å

PDB Description: Bovine heart cytochrome C oxidase at the fully oxidized state
PDB Compounds: (Y:) Cytochrome c oxidase polypeptide VIIc

SCOPe Domain Sequences for d2dyry_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2dyry_ f.23.6.1 (Y:) Mitochondrial cytochrome c oxidase subunit VIIc (aka VIIIa) {Cow (Bos taurus) [TaxId: 9913]}
hyeegpgknipfsvenkwrllammtlffgsgfaapffivrhqllkk

SCOPe Domain Coordinates for d2dyry_:

Click to download the PDB-style file with coordinates for d2dyry_.
(The format of our PDB-style files is described here.)

Timeline for d2dyry_: