Class f: Membrane and cell surface proteins and peptides [56835] (57 folds) |
Fold f.23: Single transmembrane helix [81407] (38 superfamilies) not a true fold |
Superfamily f.23.5: Mitochondrial cytochrome c oxidase subunit VIIb [81423] (1 family) automatically mapped to Pfam PF05392 |
Family f.23.5.1: Mitochondrial cytochrome c oxidase subunit VIIb [81422] (2 proteins) |
Protein automated matches [190272] (1 species) not a true protein |
Species Cow (Bos taurus) [TaxId:9913] [187064] (16 PDB entries) |
Domain d2dyrx_: 2dyr X: [131924] Other proteins in same PDB: d2dyra_, d2dyrb1, d2dyrb2, d2dyrc_, d2dyrd_, d2dyre_, d2dyrf_, d2dyrg_, d2dyrh_, d2dyri_, d2dyrj_, d2dyrl_, d2dyrm_, d2dyrn_, d2dyro1, d2dyro2, d2dyrp_, d2dyrq_, d2dyrr_, d2dyrs_, d2dyrt_, d2dyru_, d2dyrv_, d2dyrw_, d2dyry_, d2dyrz_ automated match to d1occk_ complexed with cdl, chd, cu, cua, dmu, hea, mg, na, pek, pgv, psc, tgl, unx, zn |
PDB Entry: 2dyr (more details), 1.8 Å
SCOPe Domain Sequences for d2dyrx_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2dyrx_ f.23.5.1 (X:) automated matches {Cow (Bos taurus) [TaxId: 9913]} apdfhdkygnavlasgatfcvavwvymatqigiewnpspvgrvtpkewr
Timeline for d2dyrx_:
View in 3D Domains from other chains: (mouse over for more information) d2dyra_, d2dyrb1, d2dyrb2, d2dyrc_, d2dyrd_, d2dyre_, d2dyrf_, d2dyrg_, d2dyrh_, d2dyri_, d2dyrj_, d2dyrk_, d2dyrl_, d2dyrm_, d2dyrn_, d2dyro1, d2dyro2, d2dyrp_, d2dyrq_, d2dyrr_, d2dyrs_, d2dyrt_, d2dyru_, d2dyrv_, d2dyrw_, d2dyry_, d2dyrz_ |