Lineage for d2dyru_ (2dyr U:)

  1. Root: SCOPe 2.03
  2. 1253684Class a: All alpha proteins [46456] (284 folds)
  3. 1271777Fold a.51: Cytochrome c oxidase subunit h [47693] (1 superfamily)
    4 helices; irregular array, disulfide-linked
  4. 1271778Superfamily a.51.1: Cytochrome c oxidase subunit h [47694] (1 family) (S)
  5. 1271779Family a.51.1.1: Cytochrome c oxidase subunit h [47695] (2 proteins)
  6. 1271797Protein automated matches [190271] (1 species)
    not a true protein
  7. 1271798Species Cow (Bos taurus) [TaxId:9913] [187063] (17 PDB entries)
  8. 1271802Domain d2dyru_: 2dyr U: [131921]
    Other proteins in same PDB: d2dyra_, d2dyrb1, d2dyrb2, d2dyrc_, d2dyrd_, d2dyre_, d2dyrf_, d2dyrg_, d2dyri_, d2dyrj_, d2dyrk_, d2dyrl_, d2dyrm_, d2dyrn_, d2dyro1, d2dyro2, d2dyrp_, d2dyrq_, d2dyrr_, d2dyrs_, d2dyrt_, d2dyrv_, d2dyrw_, d2dyrx_, d2dyry_, d2dyrz_
    automated match to d1ocrh_
    complexed with cdl, chd, cu, cua, dmu, hea, mg, na, pek, pgv, psc, tgl, unx, zn

Details for d2dyru_

PDB Entry: 2dyr (more details), 1.8 Å

PDB Description: Bovine heart cytochrome C oxidase at the fully oxidized state
PDB Compounds: (U:) Cytochrome c oxidase subunit VIb isoform 1

SCOPe Domain Sequences for d2dyru_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2dyru_ a.51.1.1 (U:) automated matches {Cow (Bos taurus) [TaxId: 9913]}
kiknyqtapfdsrfpnqnqtrncwqnyldfhrcekamtakggdvsvcewyrrvykslcpi
swvstwddrraegtfpgki

SCOPe Domain Coordinates for d2dyru_:

Click to download the PDB-style file with coordinates for d2dyru_.
(The format of our PDB-style files is described here.)

Timeline for d2dyru_: