Lineage for d2dyrq_ (2dyr Q:)

  1. Root: SCOPe 2.02
  2. 1236525Class f: Membrane and cell surface proteins and peptides [56835] (57 folds)
  3. 1237971Fold f.23: Single transmembrane helix [81407] (38 superfamilies)
    not a true fold
  4. 1237972Superfamily f.23.1: Mitochondrial cytochrome c oxidase subunit IV [81406] (1 family) (S)
  5. 1237973Family f.23.1.1: Mitochondrial cytochrome c oxidase subunit IV [81405] (2 proteins)
  6. 1237990Protein automated matches [190270] (1 species)
    not a true protein
  7. 1237991Species Cow (Bos taurus) [TaxId:9913] [187062] (16 PDB entries)
  8. 1237995Domain d2dyrq_: 2dyr Q: [131917]
    Other proteins in same PDB: d2dyra_, d2dyrb1, d2dyrb2, d2dyrc_, d2dyre_, d2dyrf_, d2dyrg_, d2dyrh_, d2dyri_, d2dyrj_, d2dyrk_, d2dyrl_, d2dyrm_, d2dyrn_, d2dyro1, d2dyro2, d2dyrp_, d2dyrr_, d2dyrs_, d2dyrt_, d2dyru_, d2dyrv_, d2dyrw_, d2dyrx_, d2dyry_, d2dyrz_
    automated match to d1occd_
    complexed with cdl, chd, cu, cua, dmu, hea, mg, na, pek, pgv, psc, tgl, unx, zn

Details for d2dyrq_

PDB Entry: 2dyr (more details), 1.8 Å

PDB Description: Bovine heart cytochrome C oxidase at the fully oxidized state
PDB Compounds: (Q:) Cytochrome c oxidase subunit 4 isoform 1

SCOPe Domain Sequences for d2dyrq_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2dyrq_ f.23.1.1 (Q:) automated matches {Cow (Bos taurus) [TaxId: 9913]}
svvksedyalpsyvdrrdyplpdvahvknlsasqkalkekekaswsslsidekvelyrlk
fkesfaemnrstnewktvvgaamffigftallliwekhyvygpiphtfeeewvakqtkrm
ldmkvapiqgfsakwdydknewkk

SCOPe Domain Coordinates for d2dyrq_:

Click to download the PDB-style file with coordinates for d2dyrq_.
(The format of our PDB-style files is described here.)

Timeline for d2dyrq_: