SCOPe 2.05: Domain d2dyro2: 2dyr O:1-90

Lineage for d2dyro2 (2dyr O:1-90)

1. Root: SCOPe 2.05

2. Class f: Membrane and cell surface proteins and peptides [56835] (57 folds)

3. Fold f.17: Transmembrane helix hairpin [81334] (6 superfamilies)
   two antiparallel transmembrane helices

4. Superfamily f.17.2: Cytochrome c oxidase subunit II-like, transmembrane region [81464] (2 families)

5. Family f.17.2.1: Cytochrome c oxidase subunit II-like, transmembrane region [81463] (5 proteins)

6. Protein Mitochondrial cytochrome c oxidase, subunit II [81455] (1 species)

7. Species Cow (Bos taurus) [TaxId:9913] [81454] (26 PDB entries)

8. Domain d2dyro2: 2dyr O:1-90 [131915]
   Other proteins in same PDB: d2dyra_, d2dyrb1, d2dyrc_, d2dyrd_, d2dyre_, d2dyrf_, d2dyrg_, d2dyrh_, d2dyri_, d2dyrj_, d2dyrk_, d2dyrl_, d2dyrm_, d2dyrn_, d2dyro1, d2dyrp_, d2dyrq_, d2dyrr_, d2dyrs_, d2dyrt_, d2dyru_, d2dyrv_, d2dyrw_, d2dyrx_, d2dyry_, d2dyrz_
   automated match to d1v54b2
   complexed with cdl, chd, cu, cua, dmu, hea, mg, na, pek, pgv, psc, tgl, unx, zn

Details for d2dyro2

PDB Entry: 2dyr, 1.8 Å

PDB Description: Bovine heart cytochrome C oxidase at the fully oxidized state

PDB Compounds: (O:) Cytochrome c oxidase subunit 2

SCOPe Domain Sequences for d2dyro2:

Sequence; same for both SEQRES and ATOM records:

>d2dyro2 f.17.2.1 (O:1-90) Mitochondrial cytochrome c oxidase, subunit II {Cow (Bos taurus) [TaxId: 9913]}
maypmqlgfqdatspimeellhfhdhtlmivflisslvlyiislmlttklthtstmdaqe
vetiwtilpaiililialpslrilymmdei

Timeline for d2dyro2:

• d2dyro2 first appeared in SCOP 1.73
  
• d2dyro2 appears in SCOPe 2.04
  
• d2dyro2 appears in SCOPe 2.06
  
• d2dyro2 appears in the current release, SCOPe 2.08