Lineage for d2dyro2 (2dyr O:1-90)

  1. Root: SCOPe 2.01
  2. 1058004Class f: Membrane and cell surface proteins and peptides [56835] (57 folds)
  3. 1059011Fold f.17: Transmembrane helix hairpin [81334] (5 superfamilies)
    two antiparallel transmembrane helices
  4. 1059033Superfamily f.17.2: Cytochrome c oxidase subunit II-like, transmembrane region [81464] (1 family) (S)
  5. 1059034Family f.17.2.1: Cytochrome c oxidase subunit II-like, transmembrane region [81463] (4 proteins)
  6. 1059060Protein Mitochondrial cytochrome c oxidase, subunit II [81455] (1 species)
  7. 1059061Species Cow (Bos taurus) [TaxId:9913] [81454] (14 PDB entries)
  8. 1059063Domain d2dyro2: 2dyr O:1-90 [131915]
    Other proteins in same PDB: d2dyra_, d2dyrb1, d2dyrc_, d2dyrd_, d2dyre_, d2dyrf_, d2dyrg_, d2dyrh_, d2dyri_, d2dyrj_, d2dyrk_, d2dyrl_, d2dyrm_, d2dyrn_, d2dyro1, d2dyrp_, d2dyrq_, d2dyrr_, d2dyrs_, d2dyrt_, d2dyru_, d2dyrv_, d2dyrw_, d2dyrx_, d2dyry_, d2dyrz_
    automatically matched to d1occb2
    complexed with cdl, chd, cu, cua, dmu, hea, mg, na, pek, pgv, psc, tgl, unx, zn

Details for d2dyro2

PDB Entry: 2dyr (more details), 1.8 Å

PDB Description: Bovine heart cytochrome C oxidase at the fully oxidized state
PDB Compounds: (O:) Cytochrome c oxidase subunit 2

SCOPe Domain Sequences for d2dyro2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2dyro2 f.17.2.1 (O:1-90) Mitochondrial cytochrome c oxidase, subunit II {Cow (Bos taurus) [TaxId: 9913]}
maypmqlgfqdatspimeellhfhdhtlmivflisslvlyiislmlttklthtstmdaqe
vetiwtilpaiililialpslrilymmdei

SCOPe Domain Coordinates for d2dyro2:

Click to download the PDB-style file with coordinates for d2dyro2.
(The format of our PDB-style files is described here.)

Timeline for d2dyro2: