| Class f: Membrane and cell surface proteins and peptides [56835] (60 folds) |
| Fold f.23: Single transmembrane helix [81407] (42 superfamilies) not a true fold |
Superfamily f.23.7: Mitochondrial cytochrome c oxidase subunit VIIIb (aka IX) [81431] (1 family) ![]() automatically mapped to Pfam PF02285 |
| Family f.23.7.1: Mitochondrial cytochrome c oxidase subunit VIIIb (aka IX) [81430] (2 proteins) |
| Protein automated matches [190273] (1 species) not a true protein |
| Species Cow (Bos taurus) [TaxId:9913] [187065] (25 PDB entries) |
| Domain d2dyrm_: 2dyr M: [131912] Other proteins in same PDB: d2dyra_, d2dyrb1, d2dyrb2, d2dyrc_, d2dyrd_, d2dyre_, d2dyrf_, d2dyrg_, d2dyrh_, d2dyri_, d2dyrj_, d2dyrk_, d2dyrl_, d2dyrn_, d2dyro1, d2dyro2, d2dyrp_, d2dyrq_, d2dyrr_, d2dyrs_, d2dyrt_, d2dyru_, d2dyrv_, d2dyrw_, d2dyrx_, d2dyry_ automated match to d1occm_ complexed with cdl, chd, cu, cua, dmu, hea, mg, na, pek, pgv, psc, tgl, unx, zn |
PDB Entry: 2dyr (more details), 1.8 Å
SCOPe Domain Sequences for d2dyrm_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2dyrm_ f.23.7.1 (M:) automated matches {Cow (Bos taurus) [TaxId: 9913]}
itakpaktptspkeqaiglsvtflsfllpagwvlyhldnykks
Timeline for d2dyrm_:
View in 3DDomains from other chains: (mouse over for more information) d2dyra_, d2dyrb1, d2dyrb2, d2dyrc_, d2dyrd_, d2dyre_, d2dyrf_, d2dyrg_, d2dyrh_, d2dyri_, d2dyrj_, d2dyrk_, d2dyrl_, d2dyrn_, d2dyro1, d2dyro2, d2dyrp_, d2dyrq_, d2dyrr_, d2dyrs_, d2dyrt_, d2dyru_, d2dyrv_, d2dyrw_, d2dyrx_, d2dyry_, d2dyrz_ |