Lineage for d2dyre1 (2dyr E:5-109)

  1. Root: SCOP 1.75
  2. 758332Class a: All alpha proteins [46456] (284 folds)
  3. 775276Fold a.118: alpha-alpha superhelix [48370] (24 superfamilies)
    multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix
  4. 776040Superfamily a.118.11: Cytochrome c oxidase subunit E [48479] (1 family) (S)
  5. 776041Family a.118.11.1: Cytochrome c oxidase subunit E [48480] (1 protein)
  6. 776042Protein Cytochrome c oxidase subunit E [48481] (1 species)
  7. 776043Species Cow (Bos taurus) [TaxId:9913] [48482] (14 PDB entries)
  8. 776046Domain d2dyre1: 2dyr E:5-109 [131904]
    Other proteins in same PDB: d2dyra1, d2dyrb1, d2dyrb2, d2dyrc1, d2dyrd1, d2dyrf1, d2dyrg1, d2dyrh1, d2dyri1, d2dyrj1, d2dyrk1, d2dyrl1, d2dyrm1, d2dyrn1, d2dyro1, d2dyro2, d2dyrp1, d2dyrq1, d2dyrs1, d2dyrt1, d2dyru1, d2dyrv1, d2dyrw1, d2dyrx1, d2dyry1, d2dyrz1
    automatically matched to d1occe_
    complexed with cdl, chd, cu, cua, dmu, hea, mg, na, pek, pgv, psc, tgl, unx, zn

Details for d2dyre1

PDB Entry: 2dyr (more details), 1.8 Å

PDB Description: Bovine heart cytochrome C oxidase at the fully oxidized state
PDB Compounds: (E:) Cytochrome c oxidase polypeptide Va

SCOP Domain Sequences for d2dyre1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2dyre1 a.118.11.1 (E:5-109) Cytochrome c oxidase subunit E {Cow (Bos taurus) [TaxId: 9913]}
hetdeefdarwvtyfnkpdidawelrkgmntlvgydlvpepkiidaalracrrlndfasa
vrilevvkdkagphkeiypyviqelrptlnelgistpeelgldkv

SCOP Domain Coordinates for d2dyre1:

Click to download the PDB-style file with coordinates for d2dyre1.
(The format of our PDB-style files is described here.)

Timeline for d2dyre1: