SCOPe 2.03: Domain d2dx5a1: 2dx5 A:10-130

Lineage for d2dx5a1 (2dx5 A:10-130)

1. Root: SCOPe 2.03

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.55: PH domain-like barrel [50728] (2 superfamilies)
   barrel, partly opened; n*=6, S*=12; meander; capped by an alpha-helix

4. Superfamily b.55.1: PH domain-like [50729] (14 families)

5. Family b.55.1.12: VPS36 N-terminal domain-like [141442] (1 protein)
   PfamB PB030385

6. Protein Vacuolar protein sorting protein 36, VPS36 [141443] (3 species)

7. Species Mouse (Mus musculus) [TaxId:10090] [141446] (1 PDB entry)
   Uniprot Q91XD6 10-130

8. Domain d2dx5a1: 2dx5 A:10-130 [131866]
   Other proteins in same PDB: d2dx5b1

Details for d2dx5a1

PDB Entry: 2dx5, 3.35 Å

PDB Description: The complex structure between the mouse EAP45-GLUE domain and ubiquitin

PDB Compounds: (A:) vacuolar protein sorting protein 36

SCOPe Domain Sequences for d2dx5a1:

Sequence, based on SEQRES records:

>d2dx5a1 b.55.1.12 (A:10-130) Vacuolar protein sorting protein 36, VPS36 {Mouse (Mus musculus) [TaxId: 10090]}
lleinetlviqqrgvrvydgeekikfdagtlllsthrliwrdqknneccmaiplsqivfi
eeqaagigksakivvhlhpapsnkepgpfqssknsyirlsfkehgqiefyrrlseemtqr
r

Sequence, based on observed residues (ATOM records):

>d2dx5a1 b.55.1.12 (A:10-130) Vacuolar protein sorting protein 36, VPS36 {Mouse (Mus musculus) [TaxId: 10090]}
lleinetlviqqrgvrvydgeekfdagtlllsthrliwrdqknneccmaiplsqivfiee
qakivvhlhsknsyirlsfkehgqiefyrrlseemtqrr

Timeline for d2dx5a1:

• d2dx5a1 first appeared in SCOP 1.73
  
• d2dx5a1 appears in SCOPe 2.02
  
• d2dx5a1 appears in SCOPe 2.04
  
• d2dx5a1 appears in the current release, SCOPe 2.08