Lineage for d2dx5a1 (2dx5 A:10-130)

  1. Root: SCOPe 2.01
  2. 929298Class b: All beta proteins [48724] (174 folds)
  3. 957214Fold b.55: PH domain-like barrel [50728] (2 superfamilies)
    barrel, partly opened; n*=6, S*=12; meander; capped by an alpha-helix
  4. 957215Superfamily b.55.1: PH domain-like [50729] (14 families) (S)
  5. 957728Family b.55.1.12: VPS36 N-terminal domain-like [141442] (1 protein)
    PfamB PB030385
  6. 957729Protein Vacuolar protein sorting protein 36, VPS36 [141443] (3 species)
  7. 957735Species Mouse (Mus musculus) [TaxId:10090] [141446] (1 PDB entry)
    Uniprot Q91XD6 10-130
  8. 957736Domain d2dx5a1: 2dx5 A:10-130 [131866]
    Other proteins in same PDB: d2dx5b1

Details for d2dx5a1

PDB Entry: 2dx5 (more details), 3.35 Å

PDB Description: The complex structure between the mouse EAP45-GLUE domain and ubiquitin
PDB Compounds: (A:) vacuolar protein sorting protein 36

SCOPe Domain Sequences for d2dx5a1:

Sequence, based on SEQRES records: (download)

>d2dx5a1 b.55.1.12 (A:10-130) Vacuolar protein sorting protein 36, VPS36 {Mouse (Mus musculus) [TaxId: 10090]}
lleinetlviqqrgvrvydgeekikfdagtlllsthrliwrdqknneccmaiplsqivfi
eeqaagigksakivvhlhpapsnkepgpfqssknsyirlsfkehgqiefyrrlseemtqr
r

Sequence, based on observed residues (ATOM records): (download)

>d2dx5a1 b.55.1.12 (A:10-130) Vacuolar protein sorting protein 36, VPS36 {Mouse (Mus musculus) [TaxId: 10090]}
lleinetlviqqrgvrvydgeekfdagtlllsthrliwrdqknneccmaiplsqivfiee
qakivvhlhsknsyirlsfkehgqiefyrrlseemtqrr

SCOPe Domain Coordinates for d2dx5a1:

Click to download the PDB-style file with coordinates for d2dx5a1.
(The format of our PDB-style files is described here.)

Timeline for d2dx5a1:

View in 3D
Domains from other chains:
(mouse over for more information)
d2dx5b1