Lineage for d2dwya_ (2dwy A:)

  1. Root: SCOPe 2.08
  2. Class b: All beta proteins [48724] (180 folds)
  3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. Superfamily b.1.10: Clathrin adaptor appendage domain [49348] (4 families) (S)
    contains an additional N-terminal strand
  5. Family b.1.10.2: gamma-adaptin C-terminal appendage domain-like [74857] (4 proteins)
    consist of a single subdomain
    automatically mapped to Pfam PF02883
  6. Protein automated matches [190194] (2 species)
    not a true protein
  7. Species Human (Homo sapiens) [TaxId:9606] [187060] (2 PDB entries)
  8. Domain d2dwya_: 2dwy A: [131862]
    automated match to d1om9a_

Details for d2dwya_

PDB Entry: 2dwy (more details), 2.3 Å

PDB Description: Crystal Structure Analysis of GGA1-GAE
PDB Compounds: (A:) ADP-ribosylation factor binding protein GGA1

SCOPe Domain Sequences for d2dwya_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2dwya_ b.1.10.2 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
nilpvtvydqhgfrilfhfardplpgrsdvlvvvvsmlstapqpirnivfqsavpkvmkv
klqppsgtelpafnpivhpsaitqvlllanpqkekvrlrykltftmgdqtynemgdvdqf
pppetwgsl

SCOPe Domain Coordinates for d2dwya_ are not available.

Timeline for d2dwya_:

Domains from other chains:
(mouse over for more information)
d2dwyb_, d2dwyc_, d2dwyd_