SCOPe 2.08: Domain d2dwxa_: 2dwx A:

Lineage for d2dwxa_ (2dwx A:)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.10: Clathrin adaptor appendage domain [49348] (4 families)
   contains an additional N-terminal strand

5. Family b.1.10.2: gamma-adaptin C-terminal appendage domain-like [74857] (4 proteins)
   consist of a single subdomain
   automatically mapped to Pfam PF02883

6. Protein automated matches [190194] (2 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187060] (2 PDB entries)

8. Domain d2dwxa_: 2dwx A: [131858]
   automated match to d1om9a_

Details for d2dwxa_

PDB Entry: 2dwx, 2.55 Å

PDB Description: Co-crystal Structure Analysis of GGA1-GAE with the WNSF motif

PDB Compounds: (A:) ADP-ribosylation factor-binding protein GGA1

SCOPe Domain Sequences for d2dwxa_:

Sequence; same for both SEQRES and ATOM records:

>d2dwxa_ b.1.10.2 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
nilpvtvydqhgfrilfhfardplpgrsdvlvvvvsmlstapqpirnivfqsavpkvmkv
klqppsgtelpafnpivhpsaitqvlllanpqkekvrlrykltftmgdqtynemgdvdqf
pppetwgsl

Timeline for d2dwxa_:

• d2dwxa_ first appeared in SCOP 1.73, called d2dwxa1
  
• d2dwxa_ appears in SCOPe 2.07