Lineage for d2dwdc_ (2dwd C:)

  1. Root: SCOPe 2.06
  2. 2250849Class f: Membrane and cell surface proteins and peptides [56835] (59 folds)
  3. 2252668Fold f.14: Gated ion channels [81325] (2 superfamilies)
    oligomeric transmembrane alpha-helical proteins
  4. 2252669Superfamily f.14.1: Voltage-gated ion channels [81324] (3 families) (S)
  5. 2252670Family f.14.1.1: Voltage-gated potassium channels [81323] (6 proteins)
  6. 2252772Protein automated matches [190184] (3 species)
    not a true protein
  7. 2252781Species Streptomyces lividans [TaxId:1916] [186922] (14 PDB entries)
  8. 2252785Domain d2dwdc_: 2dwd C: [131849]
    Other proteins in same PDB: d2dwda1, d2dwda2, d2dwdb1, d2dwdb2
    automated match to d1k4cc_
    complexed with f09, l2c, tba, tl

Details for d2dwdc_

PDB Entry: 2dwd (more details), 2.6 Å

PDB Description: crystal structure of KcsA-FAB-TBA complex in Tl+
PDB Compounds: (C:) Voltage-gated potassium channel

SCOPe Domain Sequences for d2dwdc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2dwdc_ f.14.1.1 (C:) automated matches {Streptomyces lividans [TaxId: 1916]}
salhwraagaatvllvivllagsylavlaergapgaqlitypralwwsvetattvgygdl
ypvtlwgrcvavvvmvagitsfglvtaalatwfvgreqerrgh

SCOPe Domain Coordinates for d2dwdc_:

Click to download the PDB-style file with coordinates for d2dwdc_.
(The format of our PDB-style files is described here.)

Timeline for d2dwdc_: