Lineage for d2dw6d1 (2dw6 D:143-389)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2826025Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2836768Superfamily c.1.11: Enolase C-terminal domain-like [51604] (3 families) (S)
    binds metal ion (magnesium or manganese) in conserved site inside barrel
    N-terminal alpha+beta domain is common to this superfamily
  5. 2836928Family c.1.11.2: D-glucarate dehydratase-like [51609] (15 proteins)
  6. 2837122Protein automated matches [226997] (13 species)
    not a true protein
  7. Species Bradyrhizobium japonicum [TaxId:375] [255123] (2 PDB entries)
  8. 2837166Domain d2dw6d1: 2dw6 D:143-389 [131814]
    Other proteins in same PDB: d2dw6a2, d2dw6b2, d2dw6c2, d2dw6d2
    automated match to d1tzza1
    complexed with mg, tar, tla; mutant

Details for d2dw6d1

PDB Entry: 2dw6 (more details), 2.3 Å

PDB Description: crystal structure of the mutant k184a of d-tartrate dehydratase from bradyrhizobium japonicum complexed with mg++ and d-tartrate
PDB Compounds: (D:) Bll6730 protein

SCOPe Domain Sequences for d2dw6d1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2dw6d1 c.1.11.2 (D:143-389) automated matches {Bradyrhizobium japonicum [TaxId: 375]}
kanprvfvyaaggyyypgkglsmlrgemrgyldrgynvvkmaiggapieedrmrieavle
eigkdaqlavdangrfnletgiayakmlrdyplfwyeevgdpldyalqaalaefypgpma
tgenlfshqdarnllryggmrpdrdwlqfdcalsyglceyqrtlevlkthgwspsrciph
gghqmslniaaglglggnesypdlfqpyggfpdgvrvenghitmpdlpgigfegksdlyk
emkalae

SCOPe Domain Coordinates for d2dw6d1:

Click to download the PDB-style file with coordinates for d2dw6d1.
(The format of our PDB-style files is described here.)

Timeline for d2dw6d1: