Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
Fold d.54: Enolase N-terminal domain-like [54825] (1 superfamily) beta(3)-alpha(3); meander and up-and-down bundle |
Superfamily d.54.1: Enolase N-terminal domain-like [54826] (2 families) |
Family d.54.1.0: automated matches [227195] (1 protein) not a true family |
Protein automated matches [226922] (88 species) not a true protein |
Domain d2dw6b2: 2dw6 B:2-142 [131811] Other proteins in same PDB: d2dw6a1, d2dw6b1, d2dw6c1, d2dw6d1 automated match to d1tzza2 complexed with mg, tar, tla; mutant |
PDB Entry: 2dw6 (more details), 2.3 Å
SCOPe Domain Sequences for d2dw6b2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2dw6b2 d.54.1.0 (B:2-142) automated matches {Bradyrhizobium japonicum [TaxId: 375]} svrivdvreitkpisspirnayidftkmttslvavvtdvvregkrvvgygfnsngrygqg glirerfasrileadpkkllneagdnldpdkvwaamminekpgghgersvavgtidmavw davakiagkplfrllaerhgv
Timeline for d2dw6b2: