SCOP 1.75: Domain d2dtsb2: 2dts B:340-444

Lineage for d2dtsb2 (2dts B:340-444)

1. Root: SCOP 1.75

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins)

6. Protein Immunoglobulin heavy chain gamma constant domain 3, CH3-gamma [88589] (5 species)

7. Species Human (Homo sapiens) [TaxId:9606] [88590] (28 PDB entries)
   Uniprot P01857 #118-327
   Uniprot P01857 118-327 # GC1_HUMAN Ig gamma-1 chain C region
   Uniprot P01857 #118-327 ! Uniprot P01857 118-327 # GC1_HUMAN Ig gamma-1 chain C region

8. Domain d2dtsb2: 2dts B:340-444 [131732]
   Other proteins in same PDB: d2dtsa1, d2dtsb1
   automatically matched to d1hzhh4
   complexed with bma, man, nag

Details for d2dtsb2

PDB Entry: 2dts, 2.2 Å

PDB Description: crystal structure of the defucosylated fc fragment from human immunoglobulin g1

PDB Compounds: (B:) Ig gamma-1 chain C region

SCOP Domain Sequences for d2dtsb2:

Sequence; same for both SEQRES and ATOM records:

>d2dtsb2 b.1.1.2 (B:340-444) Immunoglobulin heavy chain gamma constant domain 3, CH3-gamma {Human (Homo sapiens) [TaxId: 9606]}
kgqprepqvytlppsrdeltknqvsltclvkgfypsdiavewesngqpennykttppvld
sdgsfflyskltvdksrwqqgnvfscsvmhealhnhytqkslsls

Timeline for d2dtsb2:

• d2dtsb2 first appeared in SCOP 1.73
  
• d2dtsb2 appears in SCOPe 2.01
  
• d2dtsb2 appears in the current release, SCOPe 2.08