SCOP 1.73: Domain d2dtqb1: 2dtq B:237-339

Lineage for d2dtqb1 (2dtq B:237-339)

1. Root: SCOP 1.73

2. Class b: All beta proteins [48724] (165 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (27 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins)

6. Protein Immunoglobulin heavy chain gamma constant domain 2, CH2-gamma [88584] (4 species)

7. Species Human (Homo sapiens) [TaxId:9606] [88585] (25 PDB entries)

8. Domain d2dtqb1: 2dtq B:237-339 [131727]
   Other proteins in same PDB: d2dtqa2, d2dtqb2
   automatically matched to d1hzhh3
   complexed with bma, fuc, man, nag

Details for d2dtqb1

PDB Entry: 2dtq, 2 Å

PDB Description: Crystal Structure of the Fucosylated Fc Fragment from Human Immunoglobulin G1

PDB Compounds: (B:) Ig gamma-1 chain C region

SCOP Domain Sequences for d2dtqb1:

Sequence; same for both SEQRES and ATOM records:

>d2dtqb1 b.1.1.2 (B:237-339) Immunoglobulin heavy chain gamma constant domain 2, CH2-gamma {Human (Homo sapiens) [TaxId: 9606]}
gpsvflfppkpkdtlmisrtpevtcvvvdvshedpevkfnwyvdgvevhnaktkpreeqy
nstyrvvsvltvlhqdwlngkeykckvsnkalpapiektiska

Timeline for d2dtqb1:

• d2dtqb1 is new in SCOP 1.73
  
• d2dtqb1 last appears in SCOP 1.75