SCOPe 2.06: Domain d2dt5b1: 2dt5 B:4-77

Lineage for d2dt5b1 (2dt5 B:4-77)

1. Root: SCOPe 2.06

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
   core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down

4. Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (85 families)
   contains a small beta-sheet (wing)

5. Family a.4.5.38: Transcriptional repressor Rex, N-terminal domain [101007] (1 protein)

6. Protein Transcriptional repressor Rex, N-terminal domain [101008] (1 species)
   AT-rich DNA-binding protein p25

7. Species Thermus aquaticus [TaxId:271] [101009] (3 PDB entries)
   Uniprot Q9X2V5; # CASP5

8. Domain d2dt5b1: 2dt5 B:4-77 [131710]
   Other proteins in same PDB: d2dt5a2, d2dt5b2
   automatically matched to d1xcba1
   complexed with cl, gol, nad, so4

Details for d2dt5b1

PDB Entry: 2dt5, 2.16 Å

PDB Description: crystal structure of ttha1657 (at-rich dna-binding protein) from thermus thermophilus hb8

PDB Compounds: (B:) AT-rich DNA-binding protein

SCOPe Domain Sequences for d2dt5b1:

Sequence; same for both SEQRES and ATOM records:

>d2dt5b1 a.4.5.38 (B:4-77) Transcriptional repressor Rex, N-terminal domain {Thermus aquaticus [TaxId: 271]}
peaaisrlitylrileeleaqgvhrtsseqlgglaqvtafqvrkdlsyfgsygtrgvgyt
vpvlkrelrhilgl

Timeline for d2dt5b1:

• d2dt5b1 first appeared in SCOP 1.73
  
• d2dt5b1 appears in SCOPe 2.05
  
• d2dt5b1 appears in SCOPe 2.07
  
• d2dt5b1 appears in the current release, SCOPe 2.08