Lineage for d2drwb_ (2drw B:)

  1. Root: SCOPe 2.05
  2. 1949014Class e: Multi-domain proteins (alpha and beta) [56572] (68 folds)
  3. 1949285Fold e.3: beta-lactamase/transpeptidase-like [56600] (1 superfamily)
    contains a cluster of helices and an alpha+beta sandwich
  4. 1949286Superfamily e.3.1: beta-lactamase/transpeptidase-like [56601] (4 families) (S)
  5. 1949287Family e.3.1.1: beta-Lactamase/D-ala carboxypeptidase [56602] (19 proteins)
  6. 1949875Protein D-Amino acid amidase DaaA [144038] (1 species)
  7. 1949876Species Ochrobactrum anthropi [TaxId:529] [144039] (4 PDB entries)
    Uniprot Q9LCC8 2-363
  8. 1949878Domain d2drwb_: 2drw B: [131675]
    automated match to d2dnsa1
    complexed with ba

Details for d2drwb_

PDB Entry: 2drw (more details), 2.1 Å

PDB Description: The crystal structutre of D-amino acid amidase from Ochrobactrum anthropi SV3
PDB Compounds: (B:) D-amino acid amidase

SCOPe Domain Sequences for d2drwb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2drwb_ e.3.1.1 (B:) D-Amino acid amidase DaaA {Ochrobactrum anthropi [TaxId: 529]}
sdlnnaiqgilddhvargvvgvslalclpgeetslyqsgyadkfnkmpmtgdhlfriasc
tksfiatglhllvqdgtvdldepitrwfpdlpkaaqmpvrillnhrsglpdfetsmpmis
dkswtaqeivdfsfrhgvqkepwhgmeysntgyvlagmiiahetgkpysdhlrsrifapl
gmkdtwvgthetfpiereargymhaaaddenpqwdvsgagdpvdgvwdstewfplsgana
agdmvstprdivkflnalfdgrildqkrlwemkdnikpaffpgsntvanghglllmrygs
selkghlgqipghtsimgrdeetgaalmliqnsgagdfesfylkgvnepvdrvleaikns
rs

SCOPe Domain Coordinates for d2drwb_:

Click to download the PDB-style file with coordinates for d2drwb_.
(The format of our PDB-style files is described here.)

Timeline for d2drwb_: