SCOP 1.73: Domain d2dqnc1: 2dqn C:3-100

Lineage for d2dqnc1 (2dqn C:3-100)

1. Root: SCOP 1.73

2. Class a: All alpha proteins [46456] (258 folds)

3. Fold a.137: Non-globular all-alpha subunits of globular proteins [48661] (12 superfamilies)
   not a true fold

4. Superfamily a.137.12: Glu-tRNAGln amidotransferase C subunit [141000] (1 family)

5. Family a.137.12.1: Glu-tRNAGln amidotransferase C subunit [141001] (1 protein)
   Pfam PF02686

6. Protein Glu-tRNAGln amidotransferase C subunit, GatC [141002] (1 species)

7. Species Staphylococcus aureus [TaxId:1280] [141003] (5 PDB entries)

8. Domain d2dqnc1: 2dqn C:3-100 [131642]
   Other proteins in same PDB: d2dqna1, d2dqnb1, d2dqnb2
   automatically matched to 2DF4 C:2-100
   complexed with asn, mg

Details for d2dqnc1

PDB Entry: 2dqn, 2.55 Å

PDB Description: structure of trna-dependent amidotransferase gatcab complexed with asn

PDB Compounds: (C:) Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit C

SCOP Domain Sequences for d2dqnc1:

Sequence; same for both SEQRES and ATOM records:

>d2dqnc1 a.137.12.1 (C:3-100) Glu-tRNAGln amidotransferase C subunit, GatC {Staphylococcus aureus [TaxId: 1280]}
kvtreevehianlarlqispeeteemantlesildfakqndsadtegveptyhvldlqnv
lredkaikgipqelalknaketedgqfkvptimneeda

Timeline for d2dqnc1:

• d2dqnc1 is new in SCOP 1.73
  
• d2dqnc1 appears in SCOP 1.75
  
• d2dqnc1 appears in the current release, SCOPe 2.08, called d2dqnc_