SCOPe 2.07: Domain d2dqdl_: 2dqd L:

Lineage for d2dqdl_ (2dqd L:)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)

6. Protein Immunoglobulin light chain kappa variable domain, VL-kappa [88519] (16 species)
   VL-kappa domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VL-kappa domains with artificial or grafted exogenous CDRs are listed as engineered species

7. Species Mouse (Mus musculus), cluster 4 [TaxId:10090] [88531] (231 PDB entries)
   Uniprot P01645 1-106 # 95% sequense identity; KV5L_MOUSE Ig kappa chain V-V region HP 93G7 ! SQ NA # natural chimera; best hits are: Uniprot P01637 (Ig kappa chain V-V region T1) and Uniprot P01837 (Ig kappa chain C region) ! SQ NA # humanized antibody ! SQ NA # part of Fab 28 against HIV-1 RT ! Uniprot P01642 21-115 # ! KV5I_MOUSE Ig kappa chain V-V region L7 precursor

8. Domain d2dqdl_: 2dqd L: [131621]
   Other proteins in same PDB: d2dqdh1, d2dqdy_
   automated match to d1c08a_
   mutant

Details for d2dqdl_

PDB Entry: 2dqd, 1.8 Å

PDB Description: Crystal structure of hyhel-10 FV mutant (Hy50f) complexed with hen egg lysozyme

PDB Compounds: (L:) lysozyme binding Ig kappa chain V23-J2 region

SCOPe Domain Sequences for d2dqdl_:

Sequence; same for both SEQRES and ATOM records:

>d2dqdl_ b.1.1.1 (L:) Immunoglobulin light chain kappa variable domain, VL-kappa {Mouse (Mus musculus), cluster 4 [TaxId: 10090]}
divltqspatlsvtpgnsvslscrasqsignnlhwyqqkshesprllikyasqsisgips
rfsgsgsgtdftlsinsvetedfgmyfcqqsnswpytfgggtkleik

Timeline for d2dqdl_:

• d2dqdl_ first appeared in SCOP 1.73, called d2dqdl1
  
• d2dqdl_ appears in SCOPe 2.06
  
• d2dqdl_ appears in the current release, SCOPe 2.08