Lineage for d2dqcl1 (2dqc L:1-107)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 651987Fold b.1: Immunoglobulin-like beta-sandwich [48725] (27 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 651988Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 651989Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (29 proteins)
  6. 652980Protein Immunoglobulin light chain kappa variable domain, VL-kappa [88519] (14 species)
    VL-kappa domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VL-kappa domains with artificial or grafted exogenous CDRs are listed as engineered species
  7. 653521Species Mouse (Mus musculus), cluster 4 [TaxId:10090] [88531] (181 PDB entries)
  8. 653538Domain d2dqcl1: 2dqc L:1-107 [131619]
    Other proteins in same PDB: d2dqcy1
    automatically matched to d3hfml1
    mutant

Details for d2dqcl1

PDB Entry: 2dqc (more details), 1.8 Å

PDB Description: Crystal structure of hyhel-10 FV mutant(Hy33f) complexed with hen egg lysozyme
PDB Compounds: (L:) lysozyme binding Ig kappa chain V23-J2 region

SCOP Domain Sequences for d2dqcl1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2dqcl1 b.1.1.1 (L:1-107) Immunoglobulin light chain kappa variable domain, VL-kappa {Mouse (Mus musculus), cluster 4 [TaxId: 10090]}
divltqspatlsvtpgnsvslscrasqsignnlhwyqqkshesprllikyasqsisgips
rfsgsgsgtdftlsinsvetedfgmyfcqqsnswpytfgggtkleik

SCOP Domain Coordinates for d2dqcl1:

Click to download the PDB-style file with coordinates for d2dqcl1.
(The format of our PDB-style files is described here.)

Timeline for d2dqcl1:

View in 3D
Domains from other chains:
(mouse over for more information)
d2dqcy1