Lineage for d2dpdb1 (2dpd B:8-122)

  1. Root: SCOP 1.75
  2. 758332Class a: All alpha proteins [46456] (284 folds)
  3. 761139Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 761866Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (84 families) (S)
    contains a small beta-sheet (wing)
  5. 762040Family a.4.5.7: Replication terminator protein (RTP) [46807] (1 protein)
  6. 762041Protein Replication terminator protein (RTP) [46808] (1 species)
    contains long helix in the C-terminal extension; forms dimer similar to the LysR-like dimer
  7. 762042Species Bacillus subtilis [TaxId:1423] [46809] (6 PDB entries)
  8. 762055Domain d2dpdb1: 2dpd B:8-122 [131611]
    automatically matched to d1j0rb_
    mutant

Details for d2dpdb1

PDB Entry: 2dpd (more details), 3.17 Å

PDB Description: crystal structure of the replication termination protein in complex with a pseudosymmetric b-site
PDB Compounds: (B:) Replication termination protein

SCOP Domain Sequences for d2dpdb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2dpdb1 a.4.5.7 (B:8-122) Replication terminator protein (RTP) {Bacillus subtilis [TaxId: 1423]}
stgflvkqraflklymitmteqerlyglkllevlrsefkeigfkpnhtevyrslhelldd
gilkqikvkkegaklqevvlyqfkdyeaaklykkqlkveldrskkliekalsdnf

SCOP Domain Coordinates for d2dpdb1:

Click to download the PDB-style file with coordinates for d2dpdb1.
(The format of our PDB-style files is described here.)

Timeline for d2dpdb1: