SCOP 1.73: Domain d2disa1: 2dis A:8-103

Lineage for d2disa1 (2dis A:8-103)

1. Root: SCOP 1.73

2. Class d: Alpha and beta proteins (a+b) [53931] (334 folds)

3. Fold d.58: Ferredoxin-like [54861] (55 superfamilies)
   alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2

4. Superfamily d.58.7: RNA-binding domain, RBD [54928] (4 families)

5. Family d.58.7.1: Canonical RBD [54929] (67 proteins)

6. Protein Hypothetical protein FLJ20273 [143328] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [143329] (1 PDB entry)

8. Domain d2disa1: 2dis A:8-103 [131532]

Details for d2disa1

PDB Entry: 2dis

PDB Description: solution structure of the rrm domain of unnamed protein product

PDB Compounds: (A:) unnamed protein product

SCOP Domain Sequences for d2disa1:

Sequence; same for both SEQRES and ATOM records:

>d2disa1 d.58.7.1 (A:8-103) Hypothetical protein FLJ20273 {Human (Homo sapiens) [TaxId: 9606]}
ncrlfiggipkmkkreeileeiakvtegvldvivyasaadkmknrgfafveyeshraaam
arrklmpgriqlwghqiavdwaepeidvdedvmetv

Timeline for d2disa1:

• d2disa1 is new in SCOP 1.73
  
• d2disa1 appears in SCOP 1.75
  
• d2disa1 appears in the current release, SCOPe 2.08