Lineage for d2diqa1 (2diq A:8-104)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 665027Fold b.34: SH3-like barrel [50036] (18 superfamilies)
    barrel, partly opened; n*=4, S*=8; meander
    the last strand is interrupted by a turn of 3-10 helix
  4. 665781Superfamily b.34.9: Tudor/PWWP/MBT [63748] (3 families) (S)
  5. 665782Family b.34.9.1: Tudor domain [63749] (7 proteins)
    Pfam PF00567
  6. 665836Protein Tudor and KH domain-containing protein TDRKH [141205] (1 species)
  7. 665837Species Human (Homo sapiens) [TaxId:9606] [141206] (1 PDB entry)
  8. 665838Domain d2diqa1: 2diq A:8-104 [131531]

Details for d2diqa1

PDB Entry: 2diq (more details)

PDB Description: solution structure of the tudor domain of tudor and kh domain containing protein
PDB Compounds: (A:) Tudor and KH domain-containing protein

SCOP Domain Sequences for d2diqa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2diqa1 b.34.9.1 (A:8-104) Tudor and KH domain-containing protein TDRKH {Human (Homo sapiens) [TaxId: 9606]}
rslqldklvnemtqhyensvpedltvhvgdivaaplptngswyrarvlgtlengnldlyf
vdfgdngdcplkdlralrsdflslpfqaiecslaria

SCOP Domain Coordinates for d2diqa1:

Click to download the PDB-style file with coordinates for d2diqa1.
(The format of our PDB-style files is described here.)

Timeline for d2diqa1: