![]() | Class b: All beta proteins [48724] (165 folds) |
![]() | Fold b.34: SH3-like barrel [50036] (18 superfamilies) barrel, partly opened; n*=4, S*=8; meander the last strand is interrupted by a turn of 3-10 helix |
![]() | Superfamily b.34.9: Tudor/PWWP/MBT [63748] (3 families) ![]() |
![]() | Family b.34.9.1: Tudor domain [63749] (7 proteins) Pfam PF00567 |
![]() | Protein Tudor and KH domain-containing protein TDRKH [141205] (1 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [141206] (1 PDB entry) |
![]() | Domain d2diqa1: 2diq A:8-104 [131531] |
PDB Entry: 2diq (more details)
SCOP Domain Sequences for d2diqa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2diqa1 b.34.9.1 (A:8-104) Tudor and KH domain-containing protein TDRKH {Human (Homo sapiens) [TaxId: 9606]} rslqldklvnemtqhyensvpedltvhvgdivaaplptngswyrarvlgtlengnldlyf vdfgdngdcplkdlralrsdflslpfqaiecslaria
Timeline for d2diqa1: