Lineage for d2dgxa1 (2dgx A:563-635)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1906287Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 1908438Superfamily d.58.7: RNA-binding domain, RBD [54928] (6 families) (S)
  5. 1908439Family d.58.7.1: Canonical RBD [54929] (68 proteins)
  6. 1908524Protein Limkain-b1, LKAP [143324] (1 species)
    KIAA0430
  7. 1908525Species Human (Homo sapiens) [TaxId:9606] [143325] (1 PDB entry)
    Uniprot Q9Y4F3 788-870
  8. 1908526Domain d2dgxa1: 2dgx A:563-635 [131515]

Details for d2dgxa1

PDB Entry: 2dgx (more details)

PDB Description: Solution structure of the RNA recognition motif in KIAA0430 protein
PDB Compounds: (A:) KIAA0430 protein

SCOPe Domain Sequences for d2dgxa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2dgxa1 d.58.7.1 (A:563-635) Limkain-b1, LKAP {Human (Homo sapiens) [TaxId: 9606]}
dyrlsrkelqqllqeafarhgkvksvelsphtdyqlkavvqmenlqdaigavnslhryki
gskkilvslatga

SCOPe Domain Coordinates for d2dgxa1:

Click to download the PDB-style file with coordinates for d2dgxa1.
(The format of our PDB-style files is described here.)

Timeline for d2dgxa1: