Lineage for d2dg3a1 (2dg3 A:1-107)

  1. Root: SCOP 1.73
  2. 713694Class d: Alpha and beta proteins (a+b) [53931] (334 folds)
  3. 720425Fold d.26: FKBP-like [54533] (3 superfamilies)
    core: beta(2)-alpha-beta(2); antiparallel beta-sheet
  4. 720426Superfamily d.26.1: FKBP-like [54534] (3 families) (S)
  5. 720427Family d.26.1.1: FKBP immunophilin/proline isomerase [54535] (16 proteins)
  6. 720438Protein FK-506 binding protein (FKBP12), an immunophilin [54536] (2 species)
    cis-trans prolyl-isomerase
  7. 720442Species Human (Homo sapiens) [TaxId:9606] [54537] (32 PDB entries)
  8. 720449Domain d2dg3a1: 2dg3 A:1-107 [131499]
    automatically matched to d1a7xa_
    complexed with gol, rap

Details for d2dg3a1

PDB Entry: 2dg3 (more details), 1.7 Å

PDB Description: Wildtype FK506-binding protein complexed with Rapamycin
PDB Compounds: (A:) FK506-binding protein 1A

SCOP Domain Sequences for d2dg3a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2dg3a1 d.26.1.1 (A:1-107) FK-506 binding protein (FKBP12), an immunophilin {Human (Homo sapiens) [TaxId: 9606]}
gvqvetispgdgrtfpkrgqtcvvhytgmledgkkfdssrdrnkpfkfmlgkqevirgwe
egvaqmsvgqrakltispdyaygatghpgiipphatlvfdvellkle

SCOP Domain Coordinates for d2dg3a1:

Click to download the PDB-style file with coordinates for d2dg3a1.
(The format of our PDB-style files is described here.)

Timeline for d2dg3a1: