SCOP 1.73: Domain d2deyx3: 2dey X:294-663

Lineage for d2deyx3 (2dey X:294-663)

1. Root: SCOP 1.73

2. Class d: Alpha and beta proteins (a+b) [53931] (334 folds)

3. Fold d.126: Pentein, beta/alpha-propeller [55908] (1 superfamily)
   duplication: composed of 5 alpha-beta(2)-alpha-beta units arranged around pseudo fivefold axis

4. Superfamily d.126.1: Pentein [55909] (7 families)

5. Family d.126.1.5: Peptidylarginine deiminase Pad4, catalytic C-terminal domain [111152] (1 protein)
   # functionally related to the amidinotransferase, similar active sites

6. Protein Peptidylarginine deiminase Pad4, catalytic C-terminal domain [111153] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [111154] (7 PDB entries)

8. Domain d2deyx3: 2dey X:294-663 [131441]
   Other proteins in same PDB: d2deyx1, d2deyx2
   automatically matched to d1wd8a3
   complexed with ace, ca, so4; mutant

Details for d2deyx3

PDB Entry: 2dey, 2.25 Å

PDB Description: crystal structure of human peptidylarginine deiminase 4 in complex with histone h4 n-terminal tail including arg3

PDB Compounds: (X:) Protein-arginine deiminase type IV

SCOP Domain Sequences for d2deyx3:

Sequence; same for both SEQRES and ATOM records:

>d2deyx3 d.126.1.5 (X:294-663) Peptidylarginine deiminase Pad4, catalytic C-terminal domain {Human (Homo sapiens) [TaxId: 9606]}
apwimtpntqppqevyacsifenedflksvttlamkakcklticpeeenmddqwmqdeme
igyiqaphktlpvvfdsprnrglkefpikrvmgpdfgyvtrgpqtggisgldsfgnlevs
ppvtvrgkeyplgrilfgdscypsndsrqmhqalqdflsaqqvqapvklysdwlsvghvd
eflsfvpapdrkgfrlllasprscyklfqeqqneghgeallfegikkkkqqkiknilsnk
tlrehnsfvercidwnrellkrelglaesdiidipqlfklkefskaeaffpnmvnmlvlg
khlgipkpfgpvingrccleekvcslleplglqctfindfftyhirhgevhagtnvrrkp
fsfkwwnmvp

Timeline for d2deyx3:

• d2deyx3 is new in SCOP 1.73
  
• d2deyx3 appears in SCOP 1.75
  
• d2deyx3 appears in the current release, SCOPe 2.08