![]() | Class b: All beta proteins [48724] (174 folds) |
![]() | Fold b.2: Common fold of diphtheria toxin/transcription factors/cytochrome f [49379] (10 superfamilies) sandwich; 9 strands in 2 sheet; greek-key; subclass of immunoglobin-like fold |
![]() | Superfamily b.2.9: Peptidylarginine deiminase Pad4, middle domain [110083] (1 family) ![]() |
![]() | Family b.2.9.1: Peptidylarginine deiminase Pad4, middle domain [110084] (1 protein) |
![]() | Protein Peptidylarginine deiminase Pad4, middle domain [110085] (1 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [110086] (7 PDB entries) Uniprot Q9UM07 |
![]() | Domain d2deyx1: 2dey X:113-293 [131439] Other proteins in same PDB: d2deyx2, d2deyx3 automatically matched to d1wd8a1 complexed with ace, ca, so4; mutant |
PDB Entry: 2dey (more details), 2.25 Å
SCOP Domain Sequences for d2deyx1:
Sequence, based on SEQRES records: (download)
>d2deyx1 b.2.9.1 (X:113-293) Peptidylarginine deiminase Pad4, middle domain {Human (Homo sapiens) [TaxId: 9606]} veislcaditrtgkvkptravkdqrtwtwgpcgqgaillvncdrdnlessamdceddevl dsedlqdmslmtlstktpkdfftnhtlvlhvarsemdkvrvfqatrgklsskcsvvlgpk wpshylmvpggkhnmdfyvealafpdtdfpglitltislldtsnlelpeavvfqdsvvfr v
>d2deyx1 b.2.9.1 (X:113-293) Peptidylarginine deiminase Pad4, middle domain {Human (Homo sapiens) [TaxId: 9606]} veislcaditrtgkqrtwtwgpcgqgaillvncdrdnlessamdceddevldsedlqdms lmtlstktpkdfftnhtlvlhvarsemdkvrvfqatcsvvlgpkwpshylmvpggkhnmd fyvealafpdtdfpglitltislldtsnlelpeavvfqdsvvfrv
Timeline for d2deyx1: