Lineage for d2dexx3 (2dex X:294-663)

  1. Root: SCOP 1.73
  2. 713694Class d: Alpha and beta proteins (a+b) [53931] (334 folds)
  3. 732825Fold d.126: Pentein, beta/alpha-propeller [55908] (1 superfamily)
    duplication: composed of 5 alpha-beta(2)-alpha-beta units arranged around pseudo fivefold axis
  4. 732826Superfamily d.126.1: Pentein [55909] (7 families) (S)
  5. 732884Family d.126.1.5: Peptidylarginine deiminase Pad4, catalytic C-terminal domain [111152] (1 protein)
    # functionally related to the amidinotransferase, similar active sites
  6. 732885Protein Peptidylarginine deiminase Pad4, catalytic C-terminal domain [111153] (1 species)
  7. 732886Species Human (Homo sapiens) [TaxId:9606] [111154] (7 PDB entries)
  8. 732888Domain d2dexx3: 2dex X:294-663 [131438]
    Other proteins in same PDB: d2dexx1, d2dexx2
    automatically matched to d1wd8a3
    complexed with ca, so4; mutant

Details for d2dexx3

PDB Entry: 2dex (more details), 2.1 Å

PDB Description: crystal structure of human peptidylarginine deiminase 4 in complex with histone h3 n-terminal peptide including arg17
PDB Compounds: (X:) Protein-arginine deiminase type IV

SCOP Domain Sequences for d2dexx3:

Sequence; same for both SEQRES and ATOM records: (download)

>d2dexx3 d.126.1.5 (X:294-663) Peptidylarginine deiminase Pad4, catalytic C-terminal domain {Human (Homo sapiens) [TaxId: 9606]}
apwimtpntqppqevyacsifenedflksvttlamkakcklticpeeenmddqwmqdeme
igyiqaphktlpvvfdsprnrglkefpikrvmgpdfgyvtrgpqtggisgldsfgnlevs
ppvtvrgkeyplgrilfgdscypsndsrqmhqalqdflsaqqvqapvklysdwlsvghvd
eflsfvpapdrkgfrlllasprscyklfqeqqneghgeallfegikkkkqqkiknilsnk
tlrehnsfvercidwnrellkrelglaesdiidipqlfklkefskaeaffpnmvnmlvlg
khlgipkpfgpvingrccleekvcslleplglqctfindfftyhirhgevhagtnvrrkp
fsfkwwnmvp

SCOP Domain Coordinates for d2dexx3:

Click to download the PDB-style file with coordinates for d2dexx3.
(The format of our PDB-style files is described here.)

Timeline for d2dexx3: