Lineage for d2dexx1 (2dex X:113-293)

  1. Root: SCOP 1.75
  2. 781541Class b: All beta proteins [48724] (174 folds)
  3. 789808Fold b.2: Common fold of diphtheria toxin/transcription factors/cytochrome f [49379] (10 superfamilies)
    sandwich; 9 strands in 2 sheet; greek-key; subclass of immunoglobin-like fold
  4. 790349Superfamily b.2.9: Peptidylarginine deiminase Pad4, middle domain [110083] (1 family) (S)
  5. 790350Family b.2.9.1: Peptidylarginine deiminase Pad4, middle domain [110084] (1 protein)
  6. 790351Protein Peptidylarginine deiminase Pad4, middle domain [110085] (1 species)
  7. 790352Species Human (Homo sapiens) [TaxId:9606] [110086] (7 PDB entries)
    Uniprot Q9UM07
  8. 790353Domain d2dexx1: 2dex X:113-293 [131436]
    Other proteins in same PDB: d2dexx2, d2dexx3
    automatically matched to d1wd8a1
    complexed with ca, so4; mutant

Details for d2dexx1

PDB Entry: 2dex (more details), 2.1 Å

PDB Description: crystal structure of human peptidylarginine deiminase 4 in complex with histone h3 n-terminal peptide including arg17
PDB Compounds: (X:) Protein-arginine deiminase type IV

SCOP Domain Sequences for d2dexx1:

Sequence, based on SEQRES records: (download)

>d2dexx1 b.2.9.1 (X:113-293) Peptidylarginine deiminase Pad4, middle domain {Human (Homo sapiens) [TaxId: 9606]}
veislcaditrtgkvkptravkdqrtwtwgpcgqgaillvncdrdnlessamdceddevl
dsedlqdmslmtlstktpkdfftnhtlvlhvarsemdkvrvfqatrgklsskcsvvlgpk
wpshylmvpggkhnmdfyvealafpdtdfpglitltislldtsnlelpeavvfqdsvvfr
v

Sequence, based on observed residues (ATOM records): (download)

>d2dexx1 b.2.9.1 (X:113-293) Peptidylarginine deiminase Pad4, middle domain {Human (Homo sapiens) [TaxId: 9606]}
veislcaditrtgkqrtwtwgpcgqgaillvncdrdnlessamdceddevldsedlqdms
lmtlstktpkdfftnhtlvlhvarsemdkvrvfqatcsvvlgpkwpshylmvpggkhnmd
fyvealafpdtdfpglitltislldtsnlelpeavvfqdsvvfrv

SCOP Domain Coordinates for d2dexx1:

Click to download the PDB-style file with coordinates for d2dexx1.
(The format of our PDB-style files is described here.)

Timeline for d2dexx1: