Lineage for d2dewx3 (2dew X:294-663)

  1. Root: SCOP 1.75
  2. 849709Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 872041Fold d.126: Pentein, beta/alpha-propeller [55908] (1 superfamily)
    duplication: composed of 5 alpha-beta(2)-alpha-beta units arranged around pseudo fivefold axis
  4. 872042Superfamily d.126.1: Pentein [55909] (7 families) (S)
  5. 872100Family d.126.1.5: Peptidylarginine deiminase Pad4, catalytic C-terminal domain [111152] (1 protein)
    # functionally related to the amidinotransferase, similar active sites
  6. 872101Protein Peptidylarginine deiminase Pad4, catalytic C-terminal domain [111153] (1 species)
  7. 872102Species Human (Homo sapiens) [TaxId:9606] [111154] (7 PDB entries)
    Uniprot Q9UM07
  8. 872104Domain d2dewx3: 2dew X:294-663 [131435]
    Other proteins in same PDB: d2dewx1, d2dewx2
    automatically matched to d1wd8a3
    complexed with ca, so4; mutant

Details for d2dewx3

PDB Entry: 2dew (more details), 2.1 Å

PDB Description: crystal structure of human peptidylarginine deiminase 4 in complex with histone h3 n-terminal tail including arg8
PDB Compounds: (X:) Protein-arginine deiminase type IV

SCOP Domain Sequences for d2dewx3:

Sequence; same for both SEQRES and ATOM records: (download)

>d2dewx3 d.126.1.5 (X:294-663) Peptidylarginine deiminase Pad4, catalytic C-terminal domain {Human (Homo sapiens) [TaxId: 9606]}
apwimtpntqppqevyacsifenedflksvttlamkakcklticpeeenmddqwmqdeme
igyiqaphktlpvvfdsprnrglkefpikrvmgpdfgyvtrgpqtggisgldsfgnlevs
ppvtvrgkeyplgrilfgdscypsndsrqmhqalqdflsaqqvqapvklysdwlsvghvd
eflsfvpapdrkgfrlllasprscyklfqeqqneghgeallfegikkkkqqkiknilsnk
tlrehnsfvercidwnrellkrelglaesdiidipqlfklkefskaeaffpnmvnmlvlg
khlgipkpfgpvingrccleekvcslleplglqctfindfftyhirhgevhagtnvrrkp
fsfkwwnmvp

SCOP Domain Coordinates for d2dewx3:

Click to download the PDB-style file with coordinates for d2dewx3.
(The format of our PDB-style files is described here.)

Timeline for d2dewx3: