Lineage for d2dewx2 (2dew X:4-112)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 660498Fold b.6: Cupredoxin-like [49502] (2 superfamilies)
    sandwich; 7 strands in 2 sheets, greek-key
    variations: some members have additional 1-2 strands
  4. 660499Superfamily b.6.1: Cupredoxins [49503] (7 families) (S)
    contains copper-binding site
  5. 661380Family b.6.1.6: Peptidylarginine deiminase Pad4, N-terminal domain [110107] (1 protein)
    probably related to cupredoxins but lacking the metal-binding site
  6. 661381Protein Peptidylarginine deiminase Pad4, N-terminal domain [110108] (1 species)
  7. 661382Species Human (Homo sapiens) [TaxId:9606] [110109] (7 PDB entries)
  8. 661383Domain d2dewx2: 2dew X:4-112 [131434]
    Other proteins in same PDB: d2dewx1, d2dewx3
    automatically matched to d1wd8a2
    complexed with ca, so4; mutant

Details for d2dewx2

PDB Entry: 2dew (more details), 2.1 Å

PDB Description: crystal structure of human peptidylarginine deiminase 4 in complex with histone h3 n-terminal tail including arg8
PDB Compounds: (X:) Protein-arginine deiminase type IV

SCOP Domain Sequences for d2dewx2:

Sequence, based on SEQRES records: (download)

>d2dewx2 b.6.1.6 (X:4-112) Peptidylarginine deiminase Pad4, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]}
gtlirvtpeqpthavcvlgtltqldicssapedctsfsinaspgvvvdiahsppakkkst
gsstwpldpgvevtltmkaasgstgdqkvqisyygpktppvkallylta

Sequence, based on observed residues (ATOM records): (download)

>d2dewx2 b.6.1.6 (X:4-112) Peptidylarginine deiminase Pad4, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]}
gtlirvtpeqpthavcvlgtltqldicssapctsfsinaspgvvvditwpldpgvevtlt
mkaasgstgdqkvqisyygpktppvkallylta

SCOP Domain Coordinates for d2dewx2:

Click to download the PDB-style file with coordinates for d2dewx2.
(The format of our PDB-style files is described here.)

Timeline for d2dewx2: