SCOPe 2.01: Domain d2de7b2: 2de7 B:143-384

Lineage for d2de7b2 (2de7 B:143-384)

1. Root: SCOPe 2.01

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.129: TBP-like [55944] (11 superfamilies)
   beta-alpha-beta(4)-alpha

4. Superfamily d.129.3: Bet v1-like [55961] (11 families)
   contains a single copy of this fold with a alpha-beta2 insertion after the first helix; there is a cavity between the beta-sheet and the long C-terminal helix

5. Family d.129.3.3: Ring hydroxylating alpha subunit catalytic domain [55969] (6 proteins)
   Pfam PF00848; contains a few insertion and C-terminal extension compared with Bet v1

6. Protein Terminal oxygenase component of carbazole CarAa [143827] (1 species)

7. Species Janthinobacterium sp. J3 [TaxId:213804] [143828] (4 PDB entries)
   Uniprot Q84II6 143-384

8. Domain d2de7b2: 2de7 B:143-384 [131424]
   Other proteins in same PDB: d2de7a1, d2de7b1, d2de7c1
   automatically matched to 1WW9 A:143-384
   complexed with 9ca, fe2, fes

Details for d2de7b2

PDB Entry: 2de7, 2 Å

PDB Description: The substrate-bound complex between oxygenase and ferredoxin in carbazole 1,9a-dioxygenase

PDB Compounds: (B:) terminal oxygenase component of carbazole

SCOPe Domain Sequences for d2de7b2:

Sequence; same for both SEQRES and ATOM records:

>d2de7b2 d.129.3.3 (B:143-384) Terminal oxygenase component of carbazole CarAa {Janthinobacterium sp. J3 [TaxId: 213804]}
pplardtppnfldddmeilgknqiiksnwrlavengfdpshiyihkdsilvkdndlalpl
gfapggdrkqqtrvvdddvvgrkgvydligehgvpvfegtiggevvregaygekivandi
siwlpgvlkvnpfpnpdmmqfewyvpidenthyyfqtlgkpcandeerkkyeqefeskwk
pmalegfnnddiwareamvdfyaddkgwvneilfesdeaivawrklasehnqgiqtqahv
sg

Timeline for d2de7b2:

• d2de7b2 first appeared in SCOP 1.73
  
• d2de7b2 appears in SCOP 1.75
  
• d2de7b2 appears in SCOPe 2.02
  
• d2de7b2 appears in the current release, SCOPe 2.08