SCOPe 2.02: Domain d2de5b2: 2de5 B:143-384

Lineage for d2de5b2 (2de5 B:143-384)

1. Root: SCOPe 2.02

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.129: TBP-like [55944] (11 superfamilies)
   beta-alpha-beta(4)-alpha

4. Superfamily d.129.3: Bet v1-like [55961] (11 families)
   contains a single copy of this fold with a alpha-beta2 insertion after the first helix; there is a cavity between the beta-sheet and the long C-terminal helix

5. Family d.129.3.3: Ring hydroxylating alpha subunit catalytic domain [55969] (6 proteins)
   Pfam PF00848; contains a few insertion and C-terminal extension compared with Bet v1

6. Protein Terminal oxygenase component of carbazole CarAa [143827] (1 species)

7. Species Janthinobacterium sp. J3 [TaxId:213804] [143828] (4 PDB entries)
   Uniprot Q84II6 143-384

8. Domain d2de5b2: 2de5 B:143-384 [131412]
   Other proteins in same PDB: d2de5a1, d2de5b1, d2de5c1
   automatically matched to 1WW9 A:143-384
   complexed with fe2, fes

Details for d2de5b2

PDB Entry: 2de5, 1.9 Å

PDB Description: Crystal structure of the electron transfer complex between oxygenase and ferredoxin in carbazole 1,9a-dioxygenase

PDB Compounds: (B:) terminal oxygenase component of carbazole

SCOPe Domain Sequences for d2de5b2:

Sequence; same for both SEQRES and ATOM records:

>d2de5b2 d.129.3.3 (B:143-384) Terminal oxygenase component of carbazole CarAa {Janthinobacterium sp. J3 [TaxId: 213804]}
pplardtppnfldddmeilgknqiiksnwrlavengfdpshiyihkdsilvkdndlalpl
gfapggdrkqqtrvvdddvvgrkgvydligehgvpvfegtiggevvregaygekivandi
siwlpgvlkvnpfpnpdmmqfewyvpidenthyyfqtlgkpcandeerkkyeqefeskwk
pmalegfnnddiwareamvdfyaddkgwvneilfesdeaivawrklasehnqgiqtqahv
sg

Timeline for d2de5b2:

• d2de5b2 first appeared in SCOP 1.73
  
• d2de5b2 appears in SCOPe 2.01
  
• d2de5b2 appears in SCOPe 2.03
  
• d2de5b2 appears in the current release, SCOPe 2.08