SCOPe 2.06: Domain d2ddya_: 2ddy A:

Lineage for d2ddya_ (2ddy A:)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.92: Zincin-like [55485] (2 superfamilies)
   contains mixed beta sheet with connection over free side of the sheet

4. Superfamily d.92.1: Metalloproteases ("zincins"), catalytic domain [55486] (18 families)

5. Family d.92.1.0: automated matches [191495] (1 protein)
   not a true family

6. Protein automated matches [190805] (17 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [188286] (43 PDB entries)

8. Domain d2ddya_: 2ddy A: [131408]
   automated match to d1c3ia_
   complexed with ca, mdw, zn

Details for d2ddya_

PDB Entry: 2ddy

PDB Description: solution structure of matrilysin (mmp-7) complexed to constraint conformational sulfonamide inhibitor

PDB Compounds: (A:) Matrilysin

SCOPe Domain Sequences for d2ddya_:

Sequence; same for both SEQRES and ATOM records:

>d2ddya_ d.92.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
yslfpnspkwtskvvtyrivsytrdlphitvdrlvskalnmwgkeiplhfrkvvwgtadi
migfargahgdsypfdgpgntlahafapgtglggdahfdederwtdgsslginflyaath
elghslgmghssdpnavmyptygngdpqnfklsqddikgiqklygkrsnsrkk

Timeline for d2ddya_:

• d2ddya_ first appeared in SCOP 1.73, called d2ddya1
  
• d2ddya_ appears in SCOPe 2.05
  
• d2ddya_ appears in SCOPe 2.07
  
• d2ddya_ appears in the current release, SCOPe 2.08