SCOP 1.73: Domain d2d9qb1: 2d9q B:3-96

Lineage for d2d9qb1 (2d9q B:3-96)

1. Root: SCOP 1.73

2. Class b: All beta proteins [48724] (165 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (27 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.3: C2 set domains [49142] (8 proteins)

6. Protein Granulocyte colony-stimulating factor (GC-SF) receptor, N-terminal domain [141010] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [141011] (1 PDB entry)

8. Domain d2d9qb1: 2d9q B:3-96 [131347]
   Other proteins in same PDB: d2d9qa1, d2d9qb2, d2d9qb3
   complexed with nag; mutant

Details for d2d9qb1

PDB Entry: 2d9q, 2.8 Å

PDB Description: crystal structure of the human gcsf-receptor signaling complex

PDB Compounds: (B:) granulocyte colony-stimulating factor receptor

SCOP Domain Sequences for d2d9qb1:

Sequence; same for both SEQRES and ATOM records:

>d2d9qb1 b.1.1.3 (B:3-96) Granulocyte colony-stimulating factor (GC-SF) receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]}
cghisvsapivhlgdpitasciikqncshldpepqilwrlgaelqpggrqqrlsdgtqes
iitlphlnhtqaflscslnwgnslqildqvelra

Timeline for d2d9qb1:

• d2d9qb1 is new in SCOP 1.73
  
• d2d9qb1 appears in SCOP 1.75
  
• d2d9qb1 appears in the current release, SCOPe 2.08