Lineage for d2d9qa1 (2d9q A:7-174)

  1. Root: SCOP 1.75
  2. 758332Class a: All alpha proteins [46456] (284 folds)
  3. 767022Fold a.26: 4-helical cytokines [47265] (1 superfamily)
    core: 4 helices; bundle, closed; left-handed twist; 2 crossover connections
  4. 767023Superfamily a.26.1: 4-helical cytokines [47266] (3 families) (S)
    there are two different topoisomers of this fold with different entanglements of the two crossover connections
  5. 767024Family a.26.1.1: Long-chain cytokines [47267] (9 proteins)
  6. 767031Protein Granulocyte-colony stimulating factor (G-CSF) [47268] (3 species)
  7. 767038Species Human (Homo sapiens) [TaxId:9606] [47269] (5 PDB entries)
  8. 767044Domain d2d9qa1: 2d9q A:7-174 [131346]
    Other proteins in same PDB: d2d9qb1, d2d9qb2, d2d9qb3
    automatically matched to d1cd9a_
    complexed with nag; mutant

Details for d2d9qa1

PDB Entry: 2d9q (more details), 2.8 Å

PDB Description: crystal structure of the human gcsf-receptor signaling complex
PDB Compounds: (A:) csf3

SCOP Domain Sequences for d2d9qa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2d9qa1 a.26.1.1 (A:7-174) Granulocyte-colony stimulating factor (G-CSF) {Human (Homo sapiens) [TaxId: 9606]}
sslpqsfllkcleqvrkiqgdgaalqeklcatyklchpeelvllghslgipwaplsscps
qalqlagclsqlhsglflyqgllqalegispelgptldtlqldvadfattiwqqmeelgm
apalqptqgampafasafqrraggvlvashlqsflevsyrvlrhlaqp

SCOP Domain Coordinates for d2d9qa1:

Click to download the PDB-style file with coordinates for d2d9qa1.
(The format of our PDB-style files is described here.)

Timeline for d2d9qa1: