SCOP 1.73: Domain d2d82a1: 2d82 A:1077-1197

Lineage for d2d82a1 (2d82 A:1077-1197)

1. Root: SCOP 1.73

2. Class a: All alpha proteins [46456] (258 folds)

3. Fold a.29: Bromodomain-like [47363] (10 superfamilies)
   4 helices; bundle; minor mirror variant of up-and-down topology

4. Superfamily a.29.2: Bromodomain [47370] (1 family)

5. Family a.29.2.1: Bromodomain [47371] (4 proteins)

6. Protein CREB-binding protein, CBP [74712] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [74713] (2 PDB entries)

8. Domain d2d82a1: 2d82 A:1077-1197 [131327]
   automatically matched to d1jspb_
   complexed with ttr

Details for d2d82a1

PDB Entry: 2d82

PDB Description: target structure-based discovery of small molecules that block human p53 and creb binding protein (cbp) association

PDB Compounds: (A:) creb-binding protein

SCOP Domain Sequences for d2d82a1:

Sequence; same for both SEQRES and ATOM records:

>d2d82a1 a.29.2.1 (A:1077-1197) CREB-binding protein, CBP {Human (Homo sapiens) [TaxId: 9606]}
gshmrkkifkpeelrqalmptlealyrqdpeslpfrqpvdpqllgipdyfdivknpmdls
tikrkldtgqyqepwqyvddvwlmfnnawlynrktsrvykfcsklaevfeqeidpvmqsl
g

Timeline for d2d82a1:

• d2d82a1 is new in SCOP 1.73
  
• d2d82a1 appears in SCOP 1.75
  
• d2d82a1 appears in the current release, SCOPe 2.08, called d2d82a2