Lineage for d2d82a2 (2d82 A:1081-1197)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2706693Fold a.29: Bromodomain-like [47363] (15 superfamilies)
    4 helices; bundle; minor mirror variant of up-and-down topology
  4. 2706694Superfamily a.29.2: Bromodomain [47370] (2 families) (S)
  5. 2706695Family a.29.2.1: Bromodomain [47371] (6 proteins)
  6. 2706696Protein CREB-binding protein, CBP [74712] (2 species)
  7. 2706697Species Human (Homo sapiens) [TaxId:9606] [74713] (59 PDB entries)
  8. 2706786Domain d2d82a2: 2d82 A:1081-1197 [131327]
    Other proteins in same PDB: d2d82a3
    automated match to d2d82a1
    complexed with ttr

Details for d2d82a2

PDB Entry: 2d82 (more details)

PDB Description: target structure-based discovery of small molecules that block human p53 and creb binding protein (cbp) association
PDB Compounds: (A:) creb-binding protein

SCOPe Domain Sequences for d2d82a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2d82a2 a.29.2.1 (A:1081-1197) CREB-binding protein, CBP {Human (Homo sapiens) [TaxId: 9606]}
rkkifkpeelrqalmptlealyrqdpeslpfrqpvdpqllgipdyfdivknpmdlstikr
kldtgqyqepwqyvddvwlmfnnawlynrktsrvykfcsklaevfeqeidpvmqslg

SCOPe Domain Coordinates for d2d82a2:

Click to download the PDB-style file with coordinates for d2d82a2.
(The format of our PDB-style files is described here.)

Timeline for d2d82a2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2d82a3